Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MM14

Protein Details
Accession R0MM14    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-68RSVKCGKVKGVKKNVKERLKEBasic
NLS Segment(s)
PositionSequence
56-70KGVKKNVKERLKEIK
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
Amino Acid Sequences MENDFESYKEMIKKNLNKKIEVISKKYFSKEGNGICDENGVRCGKNERSVKCGKVKGVKKNVKERLKEIKKILDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.61
4 0.56
5 0.57
6 0.6
7 0.6
8 0.56
9 0.53
10 0.5
11 0.52
12 0.52
13 0.51
14 0.46
15 0.38
16 0.37
17 0.37
18 0.33
19 0.33
20 0.32
21 0.31
22 0.27
23 0.27
24 0.22
25 0.16
26 0.16
27 0.12
28 0.1
29 0.1
30 0.15
31 0.16
32 0.25
33 0.31
34 0.3
35 0.37
36 0.42
37 0.46
38 0.49
39 0.51
40 0.49
41 0.52
42 0.57
43 0.61
44 0.67
45 0.7
46 0.71
47 0.78
48 0.82
49 0.81
50 0.79
51 0.77
52 0.77
53 0.78
54 0.77
55 0.73