Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MEK4

Protein Details
Accession R0MEK4    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-22FPPKVFKKYKIDEIKNEEKNKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, nucl 8, mito 6, cyto_pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008936  Rho_GTPase_activation_prot  
Amino Acid Sequences MFPPKVFKKYKIDEIKNEEKNKLNLIEKKPACTHKLLKCVATKIVSNENVFYDYDQDEEKIIRFVPITELKEIPWLDLREEAERAFLKYNLNWYKRVVSTREVWRIEHKDINPFVLDIIKHIETTGSDIEYIFRQDNKDKDIPQHVLALDMFLGIDLPDFSEKKAATVFKRYILNNLNGIIPLPCARLSSKKPLSISRGCWNTSRGLFQELK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.8
4 0.77
5 0.72
6 0.67
7 0.62
8 0.58
9 0.55
10 0.53
11 0.52
12 0.54
13 0.59
14 0.54
15 0.57
16 0.59
17 0.59
18 0.55
19 0.53
20 0.56
21 0.53
22 0.61
23 0.58
24 0.56
25 0.55
26 0.55
27 0.51
28 0.45
29 0.4
30 0.34
31 0.4
32 0.38
33 0.34
34 0.32
35 0.29
36 0.28
37 0.26
38 0.22
39 0.17
40 0.13
41 0.13
42 0.13
43 0.12
44 0.11
45 0.11
46 0.12
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.14
53 0.2
54 0.21
55 0.23
56 0.23
57 0.22
58 0.27
59 0.27
60 0.22
61 0.21
62 0.19
63 0.18
64 0.2
65 0.21
66 0.18
67 0.19
68 0.18
69 0.15
70 0.15
71 0.16
72 0.14
73 0.14
74 0.14
75 0.14
76 0.23
77 0.28
78 0.3
79 0.3
80 0.3
81 0.33
82 0.34
83 0.36
84 0.29
85 0.24
86 0.28
87 0.34
88 0.4
89 0.37
90 0.36
91 0.39
92 0.41
93 0.41
94 0.4
95 0.33
96 0.32
97 0.31
98 0.32
99 0.25
100 0.21
101 0.18
102 0.15
103 0.14
104 0.08
105 0.11
106 0.1
107 0.1
108 0.1
109 0.1
110 0.08
111 0.11
112 0.11
113 0.08
114 0.07
115 0.08
116 0.09
117 0.09
118 0.11
119 0.09
120 0.1
121 0.12
122 0.17
123 0.19
124 0.25
125 0.29
126 0.28
127 0.32
128 0.37
129 0.37
130 0.34
131 0.35
132 0.29
133 0.26
134 0.24
135 0.2
136 0.13
137 0.1
138 0.08
139 0.05
140 0.05
141 0.03
142 0.03
143 0.03
144 0.04
145 0.07
146 0.08
147 0.08
148 0.13
149 0.13
150 0.14
151 0.19
152 0.23
153 0.24
154 0.32
155 0.33
156 0.34
157 0.4
158 0.39
159 0.43
160 0.43
161 0.43
162 0.37
163 0.36
164 0.32
165 0.26
166 0.26
167 0.19
168 0.15
169 0.13
170 0.12
171 0.12
172 0.13
173 0.16
174 0.24
175 0.29
176 0.38
177 0.44
178 0.47
179 0.51
180 0.56
181 0.62
182 0.61
183 0.61
184 0.6
185 0.59
186 0.55
187 0.55
188 0.5
189 0.49
190 0.44
191 0.44
192 0.36