Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M8A6

Protein Details
Accession R0M8A6   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-66LKHFETGKKLRKKRNYDEAIKBasic
NLS Segment(s)
PositionSequence
53-59KKLRKKR
Subcellular Location(s) cyto 9.5, cyto_nucl 8.5, nucl 6.5, E.R. 4, pero 2, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13432  TPR_16  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MEIPMDYVIEKCIVIWLLNLCILLIVVIIWRKFFSAARNENNDGFLKHFETGKKLRKKRNYDEAIKSFRKALRRANGYFDFRDVYNELGACYYEKSDYEKALLMFQLSLIQEVTNLTALKWRSICLAKLGRYEEAYEDASIYDALIDESHSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.13
5 0.14
6 0.14
7 0.11
8 0.1
9 0.09
10 0.07
11 0.05
12 0.04
13 0.05
14 0.08
15 0.08
16 0.09
17 0.1
18 0.1
19 0.12
20 0.14
21 0.18
22 0.24
23 0.32
24 0.38
25 0.44
26 0.46
27 0.46
28 0.47
29 0.42
30 0.33
31 0.27
32 0.22
33 0.18
34 0.17
35 0.19
36 0.17
37 0.22
38 0.3
39 0.37
40 0.46
41 0.52
42 0.61
43 0.68
44 0.76
45 0.79
46 0.81
47 0.8
48 0.78
49 0.79
50 0.76
51 0.74
52 0.66
53 0.58
54 0.51
55 0.45
56 0.43
57 0.38
58 0.39
59 0.39
60 0.44
61 0.45
62 0.47
63 0.49
64 0.47
65 0.43
66 0.36
67 0.29
68 0.23
69 0.24
70 0.17
71 0.14
72 0.11
73 0.11
74 0.1
75 0.09
76 0.09
77 0.07
78 0.07
79 0.07
80 0.06
81 0.07
82 0.12
83 0.13
84 0.14
85 0.15
86 0.16
87 0.16
88 0.17
89 0.17
90 0.12
91 0.1
92 0.1
93 0.12
94 0.09
95 0.1
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.08
102 0.08
103 0.08
104 0.12
105 0.13
106 0.17
107 0.17
108 0.17
109 0.2
110 0.23
111 0.24
112 0.28
113 0.34
114 0.34
115 0.39
116 0.42
117 0.39
118 0.37
119 0.38
120 0.31
121 0.28
122 0.26
123 0.2
124 0.18
125 0.15
126 0.15
127 0.13
128 0.11
129 0.07
130 0.06
131 0.06
132 0.06