Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M6C7

Protein Details
Accession R0M6C7   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
85-104VIVPLGSRRKRRIYKISQSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR000056  Ribul_P_3_epim-like  
IPR011060  RibuloseP-bd_barrel  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0016857  F:racemase and epimerase activity, acting on carbohydrates and derivatives  
GO:0005975  P:carbohydrate metabolic process  
GO:0006098  P:pentose-phosphate shunt  
Pfam View protein in Pfam  
PF00834  Ribul_P_3_epim  
PROSITE View protein in PROSITE  
PS01085  RIBUL_P_3_EPIMER_1  
Amino Acid Sequences MDRISISLLDANLLSLDTVLNDLQTNGIKRIHLDILDTSFVDNISFGPGLVNKILQYNFKFDVHIMVNYPLKVIKLLDVSRIDFVIVPLGSRRKRRIYKISQST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.04
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.08
11 0.11
12 0.13
13 0.14
14 0.15
15 0.15
16 0.16
17 0.19
18 0.19
19 0.16
20 0.16
21 0.15
22 0.16
23 0.17
24 0.16
25 0.12
26 0.1
27 0.1
28 0.08
29 0.07
30 0.05
31 0.06
32 0.05
33 0.05
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.06
40 0.08
41 0.09
42 0.12
43 0.13
44 0.16
45 0.18
46 0.18
47 0.18
48 0.16
49 0.2
50 0.18
51 0.17
52 0.15
53 0.16
54 0.17
55 0.16
56 0.17
57 0.13
58 0.12
59 0.12
60 0.11
61 0.11
62 0.14
63 0.15
64 0.2
65 0.22
66 0.23
67 0.23
68 0.23
69 0.21
70 0.16
71 0.15
72 0.15
73 0.12
74 0.11
75 0.15
76 0.24
77 0.29
78 0.37
79 0.44
80 0.5
81 0.59
82 0.68
83 0.74
84 0.77