Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MPI8

Protein Details
Accession R0MPI8    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
94-113TPSWRFYRKNPLKFVKVKNEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, nucl 6, E.R. 6, mito 3, pero 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MQTSKQKNFTKHEQTLLPYKQIDFSFSFFLPMNLLNKIDPPIDYHGQELAKKLFYLIIYLGYAISLGVGIIKSDLKYTLFAGIITVAICFVVITPSWRFYRKNPLKFVKVKNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.58
4 0.51
5 0.43
6 0.38
7 0.38
8 0.34
9 0.33
10 0.26
11 0.25
12 0.24
13 0.22
14 0.24
15 0.19
16 0.19
17 0.16
18 0.16
19 0.15
20 0.13
21 0.14
22 0.12
23 0.13
24 0.14
25 0.14
26 0.12
27 0.13
28 0.17
29 0.19
30 0.19
31 0.18
32 0.2
33 0.21
34 0.21
35 0.2
36 0.16
37 0.14
38 0.14
39 0.13
40 0.11
41 0.1
42 0.1
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.05
49 0.05
50 0.04
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.04
59 0.05
60 0.05
61 0.07
62 0.07
63 0.08
64 0.09
65 0.11
66 0.11
67 0.1
68 0.1
69 0.09
70 0.09
71 0.08
72 0.07
73 0.04
74 0.04
75 0.04
76 0.03
77 0.03
78 0.04
79 0.05
80 0.08
81 0.1
82 0.15
83 0.18
84 0.23
85 0.26
86 0.29
87 0.41
88 0.48
89 0.55
90 0.61
91 0.67
92 0.73
93 0.8