Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MFW0

Protein Details
Accession R0MFW0    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-100KEKALKMKVVIKPKRRRKNKQYNTVSDVLKHydrophilic
NLS Segment(s)
PositionSequence
75-90LKMKVVIKPKRRRKNK
Subcellular Location(s) nucl 24, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011665  BRF1_TBP-bd_dom  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF07741  BRF1  
Amino Acid Sequences MEEYVEGGYEEGGREESKSDDKENLKENKGDESNGDDEDHEPPSDELDLLTEDESKIRTAIWNEMYEDFLKEKALKMKVVIKPKRRRKNKQYNTVSDVLKSLNKRISSKINYKAIENIFEGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.13
4 0.18
5 0.21
6 0.22
7 0.28
8 0.32
9 0.36
10 0.43
11 0.47
12 0.44
13 0.44
14 0.43
15 0.43
16 0.41
17 0.37
18 0.3
19 0.28
20 0.26
21 0.24
22 0.24
23 0.16
24 0.16
25 0.17
26 0.17
27 0.12
28 0.11
29 0.1
30 0.11
31 0.11
32 0.09
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.07
42 0.07
43 0.06
44 0.06
45 0.07
46 0.08
47 0.12
48 0.14
49 0.14
50 0.16
51 0.16
52 0.17
53 0.16
54 0.15
55 0.12
56 0.1
57 0.1
58 0.09
59 0.11
60 0.16
61 0.18
62 0.17
63 0.19
64 0.28
65 0.32
66 0.42
67 0.49
68 0.53
69 0.62
70 0.72
71 0.8
72 0.83
73 0.88
74 0.89
75 0.93
76 0.93
77 0.93
78 0.92
79 0.9
80 0.86
81 0.8
82 0.7
83 0.59
84 0.5
85 0.41
86 0.36
87 0.29
88 0.28
89 0.28
90 0.32
91 0.34
92 0.38
93 0.46
94 0.49
95 0.56
96 0.6
97 0.62
98 0.59
99 0.59
100 0.61
101 0.54
102 0.49