Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KXE1

Protein Details
Accession R0KXE1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-42ALKAASTSKKEKKRWTDTKKKEEQRKVFTVHydrophilic
NLS Segment(s)
PositionSequence
9-34KEKKALKAASTSKKEKKRWTDTKKKE
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
Gene Ontology GO:0005840  C:ribosome  
Amino Acid Sequences MAKKVQETKEKKALKAASTSKKEKKRWTDTKKKEEQRKVFTVGEDLLSKVEKEVKKATDDDHLLFRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.56
4 0.56
5 0.58
6 0.66
7 0.66
8 0.71
9 0.75
10 0.75
11 0.76
12 0.77
13 0.81
14 0.83
15 0.85
16 0.86
17 0.89
18 0.9
19 0.88
20 0.87
21 0.86
22 0.84
23 0.8
24 0.74
25 0.69
26 0.6
27 0.52
28 0.44
29 0.35
30 0.28
31 0.21
32 0.17
33 0.12
34 0.12
35 0.11
36 0.1
37 0.17
38 0.16
39 0.2
40 0.27
41 0.28
42 0.32
43 0.34
44 0.35
45 0.36
46 0.39
47 0.37