Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KVN7

Protein Details
Accession R0KVN7    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-80YDEKYFKKKTIKIKNKIKKINNGFTKHydrophilic
139-170QLKFKLLKYHLKSKKHKKLRKGKDKIGKLVGDBasic
NLS Segment(s)
PositionSequence
61-73KKKTIKIKNKIKK
148-185HLKSKKHKKLRKGKDKIGKLVGDIKKGEEIIKRIKLGK
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
Amino Acid Sequences MNVDFNLLKNYINRLETLEKLFLLYSKEKHEKLTLLLIKNKYKKILKGREYTKEYDEKYFKKKTIKIKNKIKKINNGFTKGDDDYKNILWLIKNKKFIKKYILMGNMKKMIKGIDVIENLNDVNVNDDSLIVCLNCKIQLKFKLLKYHLKSKKHKKLRKGKDKIGKLVGDIKKGEEIIKRIKLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.32
4 0.34
5 0.31
6 0.26
7 0.25
8 0.25
9 0.21
10 0.22
11 0.23
12 0.22
13 0.29
14 0.36
15 0.36
16 0.39
17 0.42
18 0.38
19 0.37
20 0.43
21 0.41
22 0.39
23 0.45
24 0.47
25 0.52
26 0.57
27 0.57
28 0.55
29 0.54
30 0.57
31 0.61
32 0.66
33 0.66
34 0.68
35 0.72
36 0.74
37 0.74
38 0.69
39 0.64
40 0.6
41 0.54
42 0.52
43 0.51
44 0.47
45 0.49
46 0.51
47 0.5
48 0.52
49 0.56
50 0.59
51 0.64
52 0.7
53 0.73
54 0.79
55 0.84
56 0.85
57 0.88
58 0.84
59 0.83
60 0.81
61 0.8
62 0.76
63 0.72
64 0.63
65 0.55
66 0.52
67 0.43
68 0.38
69 0.29
70 0.25
71 0.22
72 0.21
73 0.19
74 0.16
75 0.16
76 0.13
77 0.19
78 0.25
79 0.28
80 0.37
81 0.39
82 0.47
83 0.49
84 0.5
85 0.51
86 0.47
87 0.46
88 0.45
89 0.5
90 0.48
91 0.47
92 0.48
93 0.47
94 0.42
95 0.38
96 0.31
97 0.23
98 0.19
99 0.19
100 0.16
101 0.14
102 0.16
103 0.16
104 0.15
105 0.15
106 0.14
107 0.12
108 0.11
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.08
118 0.05
119 0.05
120 0.05
121 0.06
122 0.1
123 0.13
124 0.15
125 0.22
126 0.29
127 0.35
128 0.42
129 0.46
130 0.53
131 0.54
132 0.62
133 0.61
134 0.66
135 0.68
136 0.71
137 0.77
138 0.78
139 0.85
140 0.86
141 0.88
142 0.88
143 0.9
144 0.91
145 0.92
146 0.91
147 0.9
148 0.9
149 0.9
150 0.88
151 0.85
152 0.74
153 0.66
154 0.66
155 0.59
156 0.54
157 0.46
158 0.4
159 0.35
160 0.35
161 0.36
162 0.31
163 0.33
164 0.36
165 0.42