Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M805

Protein Details
Accession R0M805   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPVKRRNHGKNRMNRGSCKPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MPVKRRNHGKNRMNRGSCKPIQCDKCGRLVPKDKAIKRFKVVPLIEQASYDDLKAATIYETFEVPRISYKNQYCVSCACHAKIVRVRSSRGRKVRYDGLVRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.75
5 0.71
6 0.67
7 0.66
8 0.65
9 0.64
10 0.64
11 0.57
12 0.59
13 0.58
14 0.54
15 0.53
16 0.58
17 0.57
18 0.57
19 0.64
20 0.6
21 0.65
22 0.69
23 0.65
24 0.59
25 0.61
26 0.55
27 0.55
28 0.5
29 0.43
30 0.41
31 0.39
32 0.35
33 0.28
34 0.25
35 0.18
36 0.17
37 0.15
38 0.09
39 0.07
40 0.06
41 0.06
42 0.06
43 0.04
44 0.04
45 0.05
46 0.05
47 0.06
48 0.06
49 0.08
50 0.08
51 0.08
52 0.11
53 0.13
54 0.15
55 0.23
56 0.25
57 0.31
58 0.36
59 0.36
60 0.35
61 0.35
62 0.37
63 0.35
64 0.36
65 0.29
66 0.31
67 0.31
68 0.37
69 0.41
70 0.43
71 0.45
72 0.46
73 0.5
74 0.54
75 0.64
76 0.66
77 0.7
78 0.7
79 0.68
80 0.71
81 0.75
82 0.73
83 0.71