Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MK44

Protein Details
Accession R0MK44    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-57AHEEAKKDKKKERKQPFVKGVDPBasic
NLS Segment(s)
PositionSequence
40-48KKDKKKERK
Subcellular Location(s) nucl 12, cyto 11, pero 3
Family & Domain DBs
Amino Acid Sequences MIESNTDNRFLEFNNKYWDILSNIVLKIYQFLIVAHEEAKKDKKKERKQPFVKGVDPLLTIIYKIARAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.32
4 0.32
5 0.32
6 0.25
7 0.24
8 0.23
9 0.19
10 0.18
11 0.17
12 0.17
13 0.14
14 0.13
15 0.11
16 0.1
17 0.06
18 0.06
19 0.08
20 0.08
21 0.09
22 0.09
23 0.1
24 0.1
25 0.12
26 0.2
27 0.24
28 0.28
29 0.36
30 0.46
31 0.55
32 0.66
33 0.74
34 0.78
35 0.82
36 0.88
37 0.89
38 0.86
39 0.78
40 0.71
41 0.62
42 0.53
43 0.44
44 0.34
45 0.26
46 0.19
47 0.16
48 0.14
49 0.13