Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MF61

Protein Details
Accession R0MF61    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
9-35NKEKLKSTVKKEGKKYLKKIKNMSKVGHydrophilic
NLS Segment(s)
PositionSequence
9-29NKEKLKSTVKKEGKKYLKKIK
Subcellular Location(s) cyto 14.5, cyto_nucl 9.5, mito 8, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MSILKKEENKEKLKSTVKKEGKKYLKKIKNMSKVGLLGGVLEGVVDVEVRAVVEEVILRIVDKGALLLPSLLPSLLPLPPLITLSITKYTIIININLPPSPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.7
4 0.72
5 0.75
6 0.77
7 0.78
8 0.79
9 0.81
10 0.83
11 0.83
12 0.81
13 0.81
14 0.84
15 0.84
16 0.83
17 0.77
18 0.7
19 0.63
20 0.55
21 0.47
22 0.37
23 0.27
24 0.16
25 0.12
26 0.1
27 0.05
28 0.04
29 0.03
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.07
62 0.07
63 0.08
64 0.07
65 0.08
66 0.09
67 0.1
68 0.1
69 0.09
70 0.1
71 0.13
72 0.17
73 0.17
74 0.17
75 0.17
76 0.16
77 0.18
78 0.19
79 0.17
80 0.16
81 0.2
82 0.22