Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0M0N6

Protein Details
Accession R0M0N6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRRKMRRTKIKKIPLVQEIEHydrophilic
NLS Segment(s)
PositionSequence
3-13RRKMRRTKIKK
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGRRKMRRTKIKKIPLVQEIERRFACPKCHQDSVVQCRIMKTQKRGYAFCSVCEAQFMCKANNLTSSIDVYSEWVDECNARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.78
4 0.72
5 0.7
6 0.62
7 0.58
8 0.51
9 0.44
10 0.4
11 0.37
12 0.38
13 0.38
14 0.43
15 0.44
16 0.46
17 0.45
18 0.48
19 0.54
20 0.56
21 0.54
22 0.47
23 0.41
24 0.39
25 0.42
26 0.43
27 0.39
28 0.37
29 0.37
30 0.41
31 0.44
32 0.44
33 0.44
34 0.46
35 0.42
36 0.36
37 0.35
38 0.3
39 0.26
40 0.27
41 0.24
42 0.16
43 0.2
44 0.21
45 0.16
46 0.19
47 0.21
48 0.2
49 0.23
50 0.24
51 0.21
52 0.21
53 0.22
54 0.18
55 0.18
56 0.16
57 0.15
58 0.13
59 0.12
60 0.11
61 0.09
62 0.1