Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MD64

Protein Details
Accession R0MD64    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSHGFRRKTRQILRKGHRKHGMPBasic
NLS Segment(s)
PositionSequence
7-21RRKTRQILRKGHRKH
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036948  Ribosomal_L21_sf  
IPR001147  Ribosomal_L21e  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01157  Ribosomal_L21e  
Amino Acid Sequences MSSHGFRRKTRQILRKGHRKHGMPGASKYLQTFKMGDYVTIMIDSAIHKGMPHKYYHGRIGKVYTVNPRSIGVVLHKRVGGKYVVKTLFVRQEHLVKFKGAELAKERDRKNNELIMQAQESGVKPELIRTIMEGPRKEFTLNLENNTPVEVKVEFYLRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.87
4 0.86
5 0.85
6 0.79
7 0.75
8 0.74
9 0.72
10 0.67
11 0.63
12 0.61
13 0.54
14 0.51
15 0.46
16 0.41
17 0.34
18 0.3
19 0.27
20 0.2
21 0.24
22 0.23
23 0.21
24 0.18
25 0.17
26 0.15
27 0.14
28 0.13
29 0.07
30 0.07
31 0.08
32 0.07
33 0.07
34 0.07
35 0.07
36 0.11
37 0.16
38 0.18
39 0.19
40 0.23
41 0.29
42 0.32
43 0.41
44 0.43
45 0.39
46 0.38
47 0.4
48 0.38
49 0.35
50 0.34
51 0.34
52 0.3
53 0.29
54 0.29
55 0.26
56 0.23
57 0.21
58 0.19
59 0.16
60 0.2
61 0.2
62 0.21
63 0.21
64 0.21
65 0.2
66 0.21
67 0.19
68 0.15
69 0.16
70 0.21
71 0.21
72 0.22
73 0.23
74 0.24
75 0.29
76 0.26
77 0.27
78 0.22
79 0.28
80 0.28
81 0.31
82 0.29
83 0.22
84 0.22
85 0.2
86 0.25
87 0.18
88 0.2
89 0.21
90 0.26
91 0.32
92 0.39
93 0.39
94 0.42
95 0.47
96 0.48
97 0.48
98 0.49
99 0.44
100 0.41
101 0.41
102 0.36
103 0.32
104 0.28
105 0.23
106 0.19
107 0.17
108 0.16
109 0.15
110 0.13
111 0.12
112 0.14
113 0.16
114 0.16
115 0.15
116 0.15
117 0.21
118 0.25
119 0.31
120 0.31
121 0.32
122 0.33
123 0.34
124 0.32
125 0.26
126 0.28
127 0.32
128 0.33
129 0.33
130 0.34
131 0.34
132 0.33
133 0.34
134 0.29
135 0.19
136 0.18
137 0.14
138 0.13
139 0.15
140 0.2