Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MG73

Protein Details
Accession R0MG73    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
131-156FFIFYCMKKYNNRKKNSKNMHVSHEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_mito 4, mito 3.5, cyto 3.5, plas 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAFLLKKKKEMLENRINESLKAKQYHLKKYESQANVINPFKSKDLTTKLLSESENASNYLNNQSFNIIKKHYNIDDTGNYTVEPKVEDLNKSFGGNNTSILSSNPLAETQSTFNKGGIVVGIVITFLFLIFFIFYCMKKYNNRKKNSKNMHVSHEIEPFTTLFSFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.66
4 0.57
5 0.51
6 0.48
7 0.44
8 0.41
9 0.38
10 0.37
11 0.44
12 0.53
13 0.55
14 0.54
15 0.52
16 0.57
17 0.64
18 0.59
19 0.55
20 0.5
21 0.5
22 0.51
23 0.48
24 0.42
25 0.34
26 0.34
27 0.31
28 0.28
29 0.23
30 0.23
31 0.27
32 0.3
33 0.31
34 0.31
35 0.31
36 0.33
37 0.32
38 0.27
39 0.24
40 0.22
41 0.2
42 0.19
43 0.17
44 0.15
45 0.16
46 0.2
47 0.17
48 0.15
49 0.14
50 0.16
51 0.17
52 0.19
53 0.21
54 0.17
55 0.18
56 0.2
57 0.24
58 0.23
59 0.23
60 0.22
61 0.23
62 0.22
63 0.23
64 0.22
65 0.18
66 0.16
67 0.15
68 0.14
69 0.11
70 0.1
71 0.07
72 0.09
73 0.1
74 0.12
75 0.12
76 0.16
77 0.16
78 0.16
79 0.16
80 0.15
81 0.16
82 0.15
83 0.15
84 0.13
85 0.12
86 0.12
87 0.12
88 0.13
89 0.1
90 0.11
91 0.1
92 0.09
93 0.09
94 0.09
95 0.11
96 0.11
97 0.14
98 0.17
99 0.17
100 0.17
101 0.17
102 0.17
103 0.15
104 0.12
105 0.09
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.04
119 0.07
120 0.09
121 0.1
122 0.13
123 0.16
124 0.2
125 0.29
126 0.4
127 0.49
128 0.56
129 0.66
130 0.73
131 0.81
132 0.88
133 0.9
134 0.89
135 0.88
136 0.84
137 0.83
138 0.8
139 0.74
140 0.67
141 0.62
142 0.52
143 0.42
144 0.38
145 0.3
146 0.25