Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MAX1

Protein Details
Accession R0MAX1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKLFKLTKRIKKNKEIKPVIKTLKVHydrophilic
NLS Segment(s)
PositionSequence
9-15KRIKKNK
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MAKLFKLTKRIKKNKEIKPVIKTLKVDNTHKGVRDEIESILLLLNTSNRHSSAYRRILDLDRHVLDTNIFLVAKKLLQVFLEEDKFEIPEFNKIFAKLRGCDNFFAIHNLLYDYLKVVLLAGYKHEQLLNFMLRNCRSVLKDNKAELIEMMAAEDRLKIEKLKINDKFVFSDRLFFFNHKFEKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.9
4 0.87
5 0.84
6 0.84
7 0.8
8 0.76
9 0.69
10 0.64
11 0.63
12 0.61
13 0.58
14 0.54
15 0.53
16 0.51
17 0.52
18 0.48
19 0.4
20 0.36
21 0.34
22 0.3
23 0.24
24 0.21
25 0.17
26 0.16
27 0.14
28 0.12
29 0.09
30 0.07
31 0.09
32 0.08
33 0.1
34 0.11
35 0.11
36 0.14
37 0.16
38 0.21
39 0.29
40 0.36
41 0.36
42 0.35
43 0.38
44 0.39
45 0.42
46 0.4
47 0.36
48 0.29
49 0.29
50 0.28
51 0.25
52 0.22
53 0.18
54 0.14
55 0.09
56 0.08
57 0.06
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.09
66 0.11
67 0.13
68 0.14
69 0.13
70 0.13
71 0.12
72 0.12
73 0.11
74 0.1
75 0.07
76 0.13
77 0.13
78 0.15
79 0.16
80 0.16
81 0.18
82 0.2
83 0.23
84 0.18
85 0.23
86 0.25
87 0.26
88 0.26
89 0.25
90 0.23
91 0.21
92 0.22
93 0.17
94 0.13
95 0.12
96 0.11
97 0.11
98 0.09
99 0.09
100 0.07
101 0.07
102 0.06
103 0.06
104 0.06
105 0.05
106 0.06
107 0.06
108 0.08
109 0.1
110 0.1
111 0.11
112 0.12
113 0.11
114 0.13
115 0.17
116 0.18
117 0.18
118 0.19
119 0.24
120 0.24
121 0.26
122 0.25
123 0.25
124 0.24
125 0.31
126 0.39
127 0.42
128 0.48
129 0.48
130 0.51
131 0.48
132 0.45
133 0.36
134 0.29
135 0.21
136 0.14
137 0.13
138 0.09
139 0.08
140 0.08
141 0.09
142 0.08
143 0.09
144 0.1
145 0.11
146 0.16
147 0.22
148 0.27
149 0.37
150 0.42
151 0.49
152 0.51
153 0.53
154 0.52
155 0.49
156 0.51
157 0.42
158 0.44
159 0.37
160 0.36
161 0.36
162 0.34
163 0.35
164 0.37