Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0ML98

Protein Details
Accession R0ML98    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
103-129IEYEKNEKGFKRNKKKKLIEDNDGFMRHydrophilic
NLS Segment(s)
PositionSequence
110-119KGFKRNKKKK
Subcellular Location(s) mito 13, nucl 9, cyto_nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031533  DUF5093  
Pfam View protein in Pfam  
PF17011  DUF5093  
Amino Acid Sequences MYSLVLNFPFKINKIKTQHIYKTKIERKENLISFALNWRYPITIEGATCLSISNENDLFLYVFKFEDINKAIDFMENTSVDVQRILEFTDVKKLVDKTNKLMIEYEKNEKGFKRNKKKKLIEDNDGFMRYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.52
3 0.57
4 0.64
5 0.71
6 0.71
7 0.73
8 0.71
9 0.75
10 0.74
11 0.75
12 0.72
13 0.68
14 0.66
15 0.69
16 0.64
17 0.57
18 0.51
19 0.42
20 0.36
21 0.37
22 0.33
23 0.24
24 0.23
25 0.19
26 0.18
27 0.18
28 0.18
29 0.15
30 0.13
31 0.12
32 0.13
33 0.13
34 0.12
35 0.12
36 0.11
37 0.08
38 0.08
39 0.09
40 0.1
41 0.1
42 0.1
43 0.1
44 0.1
45 0.1
46 0.08
47 0.08
48 0.05
49 0.05
50 0.05
51 0.06
52 0.05
53 0.09
54 0.11
55 0.12
56 0.11
57 0.12
58 0.12
59 0.12
60 0.13
61 0.1
62 0.11
63 0.1
64 0.1
65 0.11
66 0.11
67 0.1
68 0.11
69 0.1
70 0.07
71 0.08
72 0.08
73 0.08
74 0.09
75 0.09
76 0.17
77 0.17
78 0.17
79 0.21
80 0.22
81 0.27
82 0.35
83 0.37
84 0.34
85 0.42
86 0.43
87 0.4
88 0.41
89 0.38
90 0.39
91 0.4
92 0.42
93 0.39
94 0.39
95 0.41
96 0.41
97 0.46
98 0.47
99 0.54
100 0.58
101 0.64
102 0.73
103 0.81
104 0.89
105 0.9
106 0.92
107 0.9
108 0.89
109 0.84
110 0.81
111 0.75