Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KRT5

Protein Details
Accession R0KRT5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-62MSSHGFRRKTRQILRKDHRKHGMPBasic
NLS Segment(s)
PositionSequence
54-54K
Subcellular Location(s) mito 15, nucl 4, cyto_nucl 4, plas 3, cyto 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036948  Ribosomal_L21_sf  
IPR001147  Ribosomal_L21e  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01157  Ribosomal_L21e  
Amino Acid Sequences MFKPPYTREYSFSHYSPSLRYAINFFCPLFFFIIFYPQMSSHGFRRKTRQILRKDHRKHGMPGASKYLQTFKMGDYVTIMIDSAIHKGMPHKYYHGRIGKVYTVNPRSIGVVLHKRVGGKYVVKTLFVRQEHLVKFKGAELAKERDRKNNELIIQAQESGVKPELIRTIMEGPRKEFTLNLENNTPVEVKVEPYLKRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.37
4 0.34
5 0.3
6 0.26
7 0.27
8 0.25
9 0.26
10 0.29
11 0.29
12 0.25
13 0.23
14 0.24
15 0.24
16 0.22
17 0.19
18 0.15
19 0.13
20 0.18
21 0.17
22 0.16
23 0.17
24 0.14
25 0.17
26 0.18
27 0.2
28 0.23
29 0.32
30 0.37
31 0.39
32 0.48
33 0.55
34 0.62
35 0.69
36 0.71
37 0.72
38 0.77
39 0.83
40 0.86
41 0.84
42 0.83
43 0.82
44 0.78
45 0.72
46 0.69
47 0.67
48 0.61
49 0.56
50 0.54
51 0.47
52 0.43
53 0.4
54 0.35
55 0.28
56 0.25
57 0.22
58 0.15
59 0.2
60 0.19
61 0.18
62 0.15
63 0.15
64 0.13
65 0.12
66 0.11
67 0.05
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.09
75 0.14
76 0.15
77 0.16
78 0.19
79 0.23
80 0.27
81 0.35
82 0.36
83 0.33
84 0.32
85 0.34
86 0.32
87 0.29
88 0.29
89 0.28
90 0.26
91 0.25
92 0.25
93 0.23
94 0.2
95 0.19
96 0.17
97 0.15
98 0.2
99 0.2
100 0.21
101 0.22
102 0.22
103 0.21
104 0.22
105 0.2
106 0.17
107 0.18
108 0.24
109 0.24
110 0.25
111 0.26
112 0.28
113 0.32
114 0.29
115 0.3
116 0.24
117 0.31
118 0.32
119 0.34
120 0.32
121 0.25
122 0.25
123 0.23
124 0.27
125 0.2
126 0.22
127 0.23
128 0.28
129 0.35
130 0.42
131 0.42
132 0.45
133 0.5
134 0.51
135 0.51
136 0.52
137 0.47
138 0.44
139 0.44
140 0.39
141 0.35
142 0.31
143 0.25
144 0.21
145 0.19
146 0.18
147 0.17
148 0.14
149 0.13
150 0.15
151 0.18
152 0.17
153 0.17
154 0.16
155 0.22
156 0.26
157 0.33
158 0.32
159 0.33
160 0.35
161 0.36
162 0.33
163 0.27
164 0.29
165 0.33
166 0.34
167 0.34
168 0.35
169 0.34
170 0.34
171 0.35
172 0.3
173 0.2
174 0.18
175 0.15
176 0.14
177 0.19
178 0.25