Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MNV7

Protein Details
Accession R0MNV7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
314-334CDECIESRIKFRNRRCPTCGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013956  E3_ubiquit_lig_Bre1  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0006325  P:chromatin organization  
GO:0010390  P:histone monoubiquitination  
Pfam View protein in Pfam  
PF13920  zf-C3HC4_3  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
CDD cd16499  RING-HC_Bre1-like  
Amino Acid Sequences MESERDKKNLNSKLKEFMIKYEETKSKYDSCYSQLKNSLINLEEIRKFHMSRDVIKIKRMTNLNKEMKGMEYVIKDLENQIYGIQREYMNLCEYMGMLCGRNKVERDVKGRGSKVGVNSKVRDSIDLTTTPNNNNNTPTPPSDSFYENEISNLLQVCDSLTEQNNLLEGQRDDLQSQIDFLKRRNLSLEKDFEMIRLKDSFSFEYIQTYLIKINELSDSIQEICKKLENSNLERNKLTKLNIERISLIEKYKEDLRNKEIEFNILKNNYNEILEDLKNKKNEEDKKGDTPLILCNLCESKPKNVALISCMHTFCDECIESRIKFRNRRCPTCGLVFGSNDVKKIYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.61
4 0.58
5 0.53
6 0.48
7 0.47
8 0.47
9 0.48
10 0.44
11 0.46
12 0.44
13 0.44
14 0.45
15 0.47
16 0.41
17 0.4
18 0.47
19 0.47
20 0.5
21 0.5
22 0.49
23 0.47
24 0.45
25 0.45
26 0.35
27 0.36
28 0.31
29 0.3
30 0.32
31 0.29
32 0.32
33 0.31
34 0.31
35 0.29
36 0.36
37 0.33
38 0.35
39 0.44
40 0.49
41 0.47
42 0.53
43 0.56
44 0.5
45 0.53
46 0.55
47 0.53
48 0.53
49 0.61
50 0.63
51 0.6
52 0.59
53 0.53
54 0.47
55 0.42
56 0.34
57 0.27
58 0.2
59 0.19
60 0.19
61 0.18
62 0.17
63 0.16
64 0.16
65 0.13
66 0.12
67 0.12
68 0.14
69 0.15
70 0.15
71 0.15
72 0.14
73 0.15
74 0.16
75 0.17
76 0.15
77 0.14
78 0.13
79 0.12
80 0.12
81 0.1
82 0.1
83 0.09
84 0.09
85 0.1
86 0.13
87 0.15
88 0.18
89 0.19
90 0.23
91 0.3
92 0.35
93 0.39
94 0.43
95 0.48
96 0.51
97 0.51
98 0.47
99 0.43
100 0.39
101 0.39
102 0.42
103 0.41
104 0.39
105 0.4
106 0.4
107 0.42
108 0.4
109 0.35
110 0.28
111 0.24
112 0.22
113 0.21
114 0.21
115 0.21
116 0.22
117 0.23
118 0.26
119 0.26
120 0.25
121 0.26
122 0.26
123 0.26
124 0.27
125 0.27
126 0.28
127 0.27
128 0.28
129 0.27
130 0.27
131 0.24
132 0.23
133 0.23
134 0.16
135 0.15
136 0.13
137 0.11
138 0.1
139 0.1
140 0.07
141 0.05
142 0.05
143 0.05
144 0.06
145 0.06
146 0.07
147 0.08
148 0.09
149 0.09
150 0.09
151 0.1
152 0.09
153 0.09
154 0.09
155 0.08
156 0.09
157 0.11
158 0.11
159 0.1
160 0.11
161 0.12
162 0.09
163 0.1
164 0.1
165 0.11
166 0.12
167 0.13
168 0.21
169 0.2
170 0.21
171 0.25
172 0.27
173 0.28
174 0.33
175 0.36
176 0.29
177 0.3
178 0.3
179 0.26
180 0.27
181 0.23
182 0.19
183 0.16
184 0.15
185 0.16
186 0.19
187 0.18
188 0.15
189 0.17
190 0.15
191 0.16
192 0.16
193 0.15
194 0.13
195 0.12
196 0.12
197 0.11
198 0.11
199 0.09
200 0.1
201 0.09
202 0.1
203 0.09
204 0.08
205 0.1
206 0.1
207 0.12
208 0.12
209 0.13
210 0.13
211 0.16
212 0.17
213 0.17
214 0.23
215 0.27
216 0.32
217 0.42
218 0.46
219 0.45
220 0.45
221 0.45
222 0.43
223 0.4
224 0.35
225 0.32
226 0.33
227 0.39
228 0.41
229 0.41
230 0.38
231 0.36
232 0.38
233 0.32
234 0.28
235 0.22
236 0.19
237 0.2
238 0.26
239 0.32
240 0.34
241 0.38
242 0.42
243 0.46
244 0.47
245 0.51
246 0.44
247 0.43
248 0.4
249 0.36
250 0.38
251 0.33
252 0.34
253 0.28
254 0.31
255 0.26
256 0.24
257 0.23
258 0.18
259 0.2
260 0.19
261 0.25
262 0.27
263 0.31
264 0.34
265 0.35
266 0.38
267 0.43
268 0.5
269 0.52
270 0.56
271 0.57
272 0.6
273 0.63
274 0.59
275 0.51
276 0.43
277 0.39
278 0.37
279 0.31
280 0.24
281 0.24
282 0.25
283 0.25
284 0.31
285 0.29
286 0.3
287 0.37
288 0.38
289 0.38
290 0.39
291 0.39
292 0.34
293 0.37
294 0.33
295 0.31
296 0.3
297 0.27
298 0.26
299 0.25
300 0.22
301 0.23
302 0.2
303 0.17
304 0.22
305 0.26
306 0.26
307 0.33
308 0.42
309 0.45
310 0.54
311 0.62
312 0.68
313 0.73
314 0.81
315 0.8
316 0.78
317 0.75
318 0.74
319 0.7
320 0.65
321 0.59
322 0.51
323 0.49
324 0.5
325 0.45
326 0.38