Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0M704

Protein Details
Accession R0M704    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-24NTMAVDVKKKKSFRKFCYRGVDFHydrophilic
NLS Segment(s)
PositionSequence
43-49LRRKVRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
Amino Acid Sequences MNTMAVDVKKKKSFRKFCYRGVDFDEIQEMTFSEFAKLLPSKLRRKVRRGMAEKEFKLVKDCFEAKSAVQNSHDRPEIVNTFARYSIIWPSMVGNIVGVHVGNGYFPLEIKQEMIGCLLADFTPTRVHPKHGKPGIGISSSSKFVPLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.8
4 0.82
5 0.86
6 0.79
7 0.72
8 0.68
9 0.64
10 0.53
11 0.47
12 0.41
13 0.3
14 0.27
15 0.22
16 0.16
17 0.11
18 0.11
19 0.11
20 0.08
21 0.08
22 0.08
23 0.13
24 0.14
25 0.14
26 0.21
27 0.28
28 0.36
29 0.45
30 0.56
31 0.59
32 0.65
33 0.73
34 0.75
35 0.77
36 0.76
37 0.74
38 0.73
39 0.74
40 0.67
41 0.63
42 0.54
43 0.43
44 0.41
45 0.34
46 0.26
47 0.22
48 0.23
49 0.2
50 0.2
51 0.21
52 0.17
53 0.24
54 0.24
55 0.2
56 0.22
57 0.25
58 0.25
59 0.27
60 0.28
61 0.2
62 0.19
63 0.21
64 0.19
65 0.18
66 0.18
67 0.16
68 0.16
69 0.16
70 0.16
71 0.12
72 0.12
73 0.13
74 0.12
75 0.11
76 0.1
77 0.11
78 0.11
79 0.12
80 0.1
81 0.07
82 0.06
83 0.06
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.03
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.07
96 0.08
97 0.09
98 0.1
99 0.1
100 0.1
101 0.11
102 0.1
103 0.09
104 0.08
105 0.08
106 0.06
107 0.07
108 0.07
109 0.08
110 0.11
111 0.12
112 0.2
113 0.21
114 0.28
115 0.36
116 0.44
117 0.53
118 0.56
119 0.59
120 0.53
121 0.58
122 0.58
123 0.5
124 0.44
125 0.38
126 0.35
127 0.33
128 0.31