Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0M2V8

Protein Details
Accession R0M2V8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
94-113LKPKGKFKYKIPKTNTTKVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, E.R. 7, golg 4, mito_nucl 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFLYFCIPKSWRLYYTVFLGLLILCAVSIGGTAYYVIKNAKFNIMTGKNNHELTITNNSEISTEITEITYIQNIKGDEKLMYNTTDDQDFPVILKPKGKFKYKIPKTNTTKVFVKYKILFMNFKMPIEIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.36
4 0.3
5 0.24
6 0.23
7 0.18
8 0.15
9 0.12
10 0.07
11 0.04
12 0.04
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.04
20 0.05
21 0.05
22 0.07
23 0.08
24 0.1
25 0.12
26 0.13
27 0.17
28 0.16
29 0.17
30 0.24
31 0.28
32 0.29
33 0.3
34 0.35
35 0.35
36 0.35
37 0.34
38 0.26
39 0.22
40 0.22
41 0.28
42 0.23
43 0.19
44 0.19
45 0.19
46 0.18
47 0.18
48 0.16
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.06
56 0.07
57 0.07
58 0.06
59 0.09
60 0.09
61 0.1
62 0.11
63 0.11
64 0.1
65 0.11
66 0.13
67 0.12
68 0.13
69 0.13
70 0.14
71 0.14
72 0.14
73 0.13
74 0.12
75 0.11
76 0.11
77 0.1
78 0.14
79 0.16
80 0.17
81 0.22
82 0.23
83 0.32
84 0.39
85 0.46
86 0.45
87 0.51
88 0.62
89 0.67
90 0.75
91 0.73
92 0.76
93 0.77
94 0.83
95 0.78
96 0.73
97 0.68
98 0.64
99 0.64
100 0.56
101 0.57
102 0.5
103 0.51
104 0.51
105 0.5
106 0.48
107 0.43
108 0.5
109 0.44
110 0.42