Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KWZ6

Protein Details
Accession R0KWZ6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-104KGTPIHKLPKKLRPKKTRAQRKALTKKQLEREVPBasic
NLS Segment(s)
PositionSequence
74-109PIHKLPKKLRPKKTRAQRKALTKKQLEREVPKVWKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MQISVDHFREKTIEELESEIITLKNELLELRQKKVSATVEPEEIKTCRKTIATALKVRREKYLEELVEKYKGTPIHKLPKKLRPKKTRAQRKALTKKQLEREVPKVWKKSLKYPKVFYSYSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.2
4 0.19
5 0.17
6 0.14
7 0.11
8 0.11
9 0.1
10 0.08
11 0.07
12 0.07
13 0.08
14 0.1
15 0.19
16 0.21
17 0.24
18 0.27
19 0.27
20 0.27
21 0.33
22 0.33
23 0.27
24 0.3
25 0.28
26 0.3
27 0.31
28 0.31
29 0.28
30 0.26
31 0.25
32 0.21
33 0.2
34 0.17
35 0.17
36 0.17
37 0.21
38 0.3
39 0.33
40 0.39
41 0.43
42 0.5
43 0.53
44 0.53
45 0.5
46 0.42
47 0.37
48 0.35
49 0.37
50 0.3
51 0.28
52 0.3
53 0.27
54 0.27
55 0.26
56 0.21
57 0.17
58 0.19
59 0.18
60 0.23
61 0.28
62 0.37
63 0.42
64 0.5
65 0.55
66 0.61
67 0.71
68 0.74
69 0.78
70 0.78
71 0.82
72 0.83
73 0.87
74 0.89
75 0.87
76 0.87
77 0.84
78 0.85
79 0.88
80 0.87
81 0.86
82 0.83
83 0.82
84 0.81
85 0.82
86 0.79
87 0.74
88 0.72
89 0.71
90 0.72
91 0.72
92 0.68
93 0.65
94 0.65
95 0.63
96 0.67
97 0.69
98 0.7
99 0.71
100 0.72
101 0.75
102 0.74