Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MP94

Protein Details
Accession R0MP94    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-69PEIVKECKKKSRKIKEKCKDEKDEPSKLBasic
NLS Segment(s)
PositionSequence
49-76KKKSRKIKEKCKDEKDEPSKLSLMKRRR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MINEILTKFLQTTKFTTSKTERNFVPRRVGLGYDLVTEFNDPEIVKECKKKSRKIKEKCKDEKDEPSKLSLMKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.39
4 0.41
5 0.46
6 0.48
7 0.5
8 0.45
9 0.51
10 0.57
11 0.53
12 0.55
13 0.47
14 0.45
15 0.41
16 0.39
17 0.3
18 0.26
19 0.22
20 0.15
21 0.14
22 0.12
23 0.1
24 0.1
25 0.08
26 0.06
27 0.07
28 0.05
29 0.06
30 0.1
31 0.13
32 0.15
33 0.22
34 0.26
35 0.35
36 0.42
37 0.51
38 0.58
39 0.67
40 0.75
41 0.79
42 0.87
43 0.88
44 0.92
45 0.93
46 0.92
47 0.89
48 0.85
49 0.86
50 0.82
51 0.8
52 0.71
53 0.64
54 0.58
55 0.52
56 0.54