Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MH05

Protein Details
Accession R0MH05   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-53YSCKNSKIYKMYKKTPKPLRYLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015257  Maf1  
IPR038564  Maf1_sf  
Gene Ontology GO:0016480  P:negative regulation of transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF09174  Maf1  
Amino Acid Sequences MKFLEIKQILRTNEILKTIQEQYPIILDLEVYSCKNSKIYKMYKKTPKPLRYLLETLQRVYPDYSFIGEDWSNFKKLDYQNVANELIYSFLTFYKVKEKVDELVQFLGLIIDKTVFIDGCEIFSYTSREGPFEKDNWHFCFLFYSRSNKRVLFLSVRNTEIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.3
3 0.25
4 0.28
5 0.29
6 0.28
7 0.27
8 0.24
9 0.22
10 0.22
11 0.22
12 0.17
13 0.13
14 0.11
15 0.09
16 0.11
17 0.11
18 0.1
19 0.11
20 0.11
21 0.12
22 0.16
23 0.18
24 0.22
25 0.3
26 0.39
27 0.48
28 0.56
29 0.65
30 0.71
31 0.78
32 0.82
33 0.83
34 0.81
35 0.78
36 0.77
37 0.71
38 0.67
39 0.63
40 0.57
41 0.56
42 0.49
43 0.44
44 0.38
45 0.33
46 0.28
47 0.25
48 0.21
49 0.13
50 0.13
51 0.12
52 0.11
53 0.1
54 0.12
55 0.11
56 0.11
57 0.14
58 0.15
59 0.15
60 0.15
61 0.15
62 0.18
63 0.19
64 0.26
65 0.27
66 0.28
67 0.29
68 0.31
69 0.32
70 0.25
71 0.24
72 0.16
73 0.12
74 0.09
75 0.07
76 0.05
77 0.05
78 0.08
79 0.08
80 0.09
81 0.16
82 0.18
83 0.19
84 0.2
85 0.22
86 0.21
87 0.27
88 0.28
89 0.22
90 0.2
91 0.2
92 0.18
93 0.16
94 0.14
95 0.08
96 0.06
97 0.05
98 0.04
99 0.04
100 0.05
101 0.05
102 0.05
103 0.05
104 0.07
105 0.07
106 0.08
107 0.09
108 0.09
109 0.09
110 0.11
111 0.14
112 0.13
113 0.17
114 0.16
115 0.17
116 0.18
117 0.23
118 0.25
119 0.24
120 0.29
121 0.32
122 0.37
123 0.4
124 0.43
125 0.38
126 0.34
127 0.38
128 0.34
129 0.35
130 0.33
131 0.38
132 0.4
133 0.44
134 0.48
135 0.42
136 0.43
137 0.4
138 0.43
139 0.41
140 0.41
141 0.46
142 0.46