Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KY97

Protein Details
Accession R0KY97    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
249-268EPGPEEKKAKKEESNNKKEEAcidic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 9.666, nucl 8, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR031507  PTP2  
Pfam View protein in Pfam  
PF17022  PTP2  
Amino Acid Sequences MFLSLNRKLFTVASLLTVIRTMASVAPPQGGIMVPNRAQQQMLPAVVDPRKAVCNIQYINGKKIIPANNNNPAECQRDLIERAKMRQAQAIETAARAVQTIEHIKQEPKCVKSVDLRETQCIKTKLLNELKNEPEYTVTGEENKVNVFKKGKKIMLAANIQHHFIKVEKPPSEQFQIVKKAKEAYVFNAIGEVLSTKQTRKRPAPQCICPGKSTPQTAEGTPLINECKQAECKNYDLFVNILSNTTVSEPGPEEKKAKKEESNNKKEEGKENGSNST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.15
5 0.14
6 0.1
7 0.09
8 0.08
9 0.08
10 0.1
11 0.13
12 0.13
13 0.14
14 0.14
15 0.14
16 0.14
17 0.12
18 0.11
19 0.12
20 0.17
21 0.17
22 0.21
23 0.24
24 0.24
25 0.24
26 0.23
27 0.25
28 0.25
29 0.24
30 0.2
31 0.19
32 0.24
33 0.25
34 0.26
35 0.21
36 0.19
37 0.2
38 0.21
39 0.22
40 0.19
41 0.26
42 0.26
43 0.31
44 0.36
45 0.37
46 0.39
47 0.41
48 0.38
49 0.31
50 0.37
51 0.39
52 0.38
53 0.43
54 0.48
55 0.53
56 0.56
57 0.54
58 0.5
59 0.46
60 0.43
61 0.35
62 0.29
63 0.21
64 0.22
65 0.26
66 0.27
67 0.32
68 0.29
69 0.32
70 0.37
71 0.39
72 0.36
73 0.36
74 0.33
75 0.28
76 0.28
77 0.28
78 0.21
79 0.18
80 0.17
81 0.13
82 0.12
83 0.1
84 0.07
85 0.05
86 0.08
87 0.12
88 0.13
89 0.15
90 0.17
91 0.2
92 0.22
93 0.3
94 0.33
95 0.31
96 0.33
97 0.31
98 0.33
99 0.36
100 0.41
101 0.39
102 0.4
103 0.4
104 0.42
105 0.44
106 0.43
107 0.42
108 0.37
109 0.33
110 0.29
111 0.3
112 0.34
113 0.39
114 0.41
115 0.38
116 0.41
117 0.43
118 0.41
119 0.38
120 0.3
121 0.23
122 0.19
123 0.17
124 0.13
125 0.11
126 0.1
127 0.11
128 0.11
129 0.11
130 0.11
131 0.12
132 0.11
133 0.14
134 0.17
135 0.21
136 0.28
137 0.34
138 0.35
139 0.35
140 0.37
141 0.38
142 0.39
143 0.39
144 0.34
145 0.34
146 0.33
147 0.32
148 0.29
149 0.26
150 0.2
151 0.16
152 0.19
153 0.17
154 0.23
155 0.24
156 0.27
157 0.3
158 0.33
159 0.36
160 0.33
161 0.31
162 0.3
163 0.39
164 0.39
165 0.37
166 0.35
167 0.34
168 0.34
169 0.36
170 0.31
171 0.25
172 0.3
173 0.29
174 0.27
175 0.24
176 0.22
177 0.17
178 0.16
179 0.12
180 0.05
181 0.09
182 0.1
183 0.12
184 0.19
185 0.26
186 0.34
187 0.42
188 0.51
189 0.58
190 0.68
191 0.75
192 0.75
193 0.79
194 0.8
195 0.74
196 0.66
197 0.6
198 0.56
199 0.53
200 0.5
201 0.42
202 0.39
203 0.39
204 0.37
205 0.37
206 0.31
207 0.26
208 0.22
209 0.22
210 0.19
211 0.18
212 0.19
213 0.16
214 0.2
215 0.24
216 0.27
217 0.31
218 0.31
219 0.34
220 0.36
221 0.36
222 0.32
223 0.28
224 0.25
225 0.21
226 0.2
227 0.17
228 0.14
229 0.13
230 0.12
231 0.11
232 0.12
233 0.12
234 0.1
235 0.12
236 0.13
237 0.18
238 0.22
239 0.24
240 0.29
241 0.34
242 0.42
243 0.47
244 0.52
245 0.55
246 0.63
247 0.7
248 0.76
249 0.8
250 0.77
251 0.75
252 0.74
253 0.7
254 0.68
255 0.66
256 0.62
257 0.6