Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KQW0

Protein Details
Accession R0KQW0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-26GYYVKDKKKEPLKNTYKHKIAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11cyto 11cyto_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR033489  RBBP6  
IPR025829  Zn_knuckle_CX2CX3GHX4C  
IPR027370  Znf-RING_euk  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
GO:0006397  P:mRNA processing  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF13696  zf-CCHC_2  
PF13445  zf-RING_UBOX  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MSATGYYVKDKKKEPLKNTYKHKIAPPETYVCFRCGNKGHFILHCPTNEDKAFDIARIRKPSGIPKDFLVQVKGDDIGENSGMLVTTEGYYVKAQPQIHEWKRNVKKTNVSQIPNALKCPACNKLYNQPIKTNCRHTFCERCVNIGDKCKICKRVITNLIEDIEVKYELDAFLDKNIISN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.74
4 0.78
5 0.84
6 0.84
7 0.8
8 0.76
9 0.75
10 0.74
11 0.7
12 0.67
13 0.63
14 0.59
15 0.55
16 0.55
17 0.5
18 0.42
19 0.41
20 0.35
21 0.36
22 0.36
23 0.37
24 0.38
25 0.4
26 0.41
27 0.38
28 0.41
29 0.39
30 0.37
31 0.33
32 0.31
33 0.29
34 0.31
35 0.3
36 0.28
37 0.24
38 0.24
39 0.24
40 0.2
41 0.25
42 0.24
43 0.31
44 0.34
45 0.34
46 0.32
47 0.34
48 0.42
49 0.46
50 0.44
51 0.39
52 0.36
53 0.38
54 0.39
55 0.38
56 0.3
57 0.2
58 0.17
59 0.17
60 0.15
61 0.12
62 0.09
63 0.08
64 0.07
65 0.07
66 0.06
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.04
75 0.04
76 0.05
77 0.06
78 0.06
79 0.08
80 0.12
81 0.12
82 0.13
83 0.18
84 0.27
85 0.32
86 0.39
87 0.39
88 0.45
89 0.53
90 0.6
91 0.6
92 0.55
93 0.59
94 0.59
95 0.68
96 0.65
97 0.59
98 0.53
99 0.55
100 0.56
101 0.49
102 0.43
103 0.35
104 0.28
105 0.26
106 0.29
107 0.28
108 0.24
109 0.25
110 0.28
111 0.35
112 0.44
113 0.51
114 0.49
115 0.51
116 0.56
117 0.61
118 0.63
119 0.63
120 0.61
121 0.58
122 0.61
123 0.61
124 0.63
125 0.6
126 0.65
127 0.55
128 0.52
129 0.5
130 0.49
131 0.46
132 0.46
133 0.47
134 0.41
135 0.46
136 0.5
137 0.54
138 0.51
139 0.53
140 0.51
141 0.55
142 0.6
143 0.58
144 0.55
145 0.53
146 0.52
147 0.45
148 0.39
149 0.3
150 0.23
151 0.19
152 0.15
153 0.11
154 0.1
155 0.1
156 0.11
157 0.11
158 0.09
159 0.1
160 0.12