Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MIW2

Protein Details
Accession R0MIW2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
116-137VWITEIFKRRRRENEERGEEERBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MEKNKRDKVNNNNNKVNNKIRFENEEEGPIQIVLNKKEEIMEEKPLVEESKGEEESKEESVKEESVNTTTPPTTTTTHNTTPPPTTTEEITPLEKVTAFVTALVKAITDGLIKAFVWITEIFKRRRRENEERGEEEREEEIREENV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.77
3 0.75
4 0.72
5 0.67
6 0.63
7 0.59
8 0.58
9 0.58
10 0.56
11 0.48
12 0.43
13 0.38
14 0.33
15 0.29
16 0.23
17 0.17
18 0.14
19 0.16
20 0.15
21 0.17
22 0.17
23 0.16
24 0.17
25 0.19
26 0.22
27 0.21
28 0.24
29 0.21
30 0.21
31 0.22
32 0.22
33 0.21
34 0.15
35 0.13
36 0.11
37 0.15
38 0.16
39 0.16
40 0.15
41 0.16
42 0.18
43 0.19
44 0.17
45 0.12
46 0.12
47 0.14
48 0.14
49 0.13
50 0.12
51 0.1
52 0.11
53 0.12
54 0.11
55 0.11
56 0.1
57 0.1
58 0.1
59 0.12
60 0.12
61 0.14
62 0.18
63 0.22
64 0.24
65 0.27
66 0.27
67 0.26
68 0.27
69 0.26
70 0.24
71 0.22
72 0.21
73 0.19
74 0.19
75 0.2
76 0.2
77 0.2
78 0.18
79 0.15
80 0.14
81 0.13
82 0.12
83 0.09
84 0.09
85 0.07
86 0.08
87 0.09
88 0.09
89 0.09
90 0.08
91 0.08
92 0.07
93 0.07
94 0.06
95 0.06
96 0.05
97 0.06
98 0.07
99 0.07
100 0.08
101 0.07
102 0.07
103 0.09
104 0.09
105 0.13
106 0.19
107 0.26
108 0.32
109 0.39
110 0.46
111 0.52
112 0.62
113 0.68
114 0.71
115 0.75
116 0.8
117 0.82
118 0.81
119 0.78
120 0.72
121 0.63
122 0.55
123 0.47
124 0.37
125 0.3
126 0.25