Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MFP8

Protein Details
Accession R0MFP8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRRKMRRTKIKKIPLVQAIEHydrophilic
NLS Segment(s)
PositionSequence
3-13RRKMRRTKIKK
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGRRKMRRTKIKKIPLVQAIERRFACPKCHQDSVVQCRIMKTQKRGYAFCSVCEAQFMCKANNLTSPIDVYSEWVDECNARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.77
4 0.71
5 0.69
6 0.61
7 0.58
8 0.52
9 0.46
10 0.44
11 0.39
12 0.39
13 0.39
14 0.45
15 0.44
16 0.47
17 0.45
18 0.46
19 0.53
20 0.56
21 0.54
22 0.47
23 0.41
24 0.39
25 0.42
26 0.43
27 0.39
28 0.37
29 0.37
30 0.41
31 0.44
32 0.44
33 0.44
34 0.46
35 0.42
36 0.36
37 0.35
38 0.3
39 0.26
40 0.27
41 0.24
42 0.16
43 0.2
44 0.21
45 0.16
46 0.19
47 0.21
48 0.21
49 0.25
50 0.26
51 0.23
52 0.22
53 0.23
54 0.2
55 0.2
56 0.19
57 0.17
58 0.15
59 0.15
60 0.14
61 0.13
62 0.13