Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YY96

Protein Details
Accession R7YY96   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
64-89LKSTTSRDNSRAKKRKRNDDGDMYDLHydrophilic
NLS Segment(s)
PositionSequence
73-80SRAKKRKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSSYEDNIEGTIMSPATLGDFNNDTSVQISQIIHMLRQVQEAQKNMMKRVKKVERALAKVKDDLKSTTSRDNSRAKKRKRNDDGDMYDLVLEHYEADVAATWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.08
4 0.08
5 0.08
6 0.09
7 0.11
8 0.11
9 0.13
10 0.14
11 0.12
12 0.13
13 0.13
14 0.1
15 0.11
16 0.11
17 0.09
18 0.12
19 0.12
20 0.11
21 0.12
22 0.14
23 0.12
24 0.14
25 0.16
26 0.16
27 0.19
28 0.21
29 0.23
30 0.24
31 0.24
32 0.27
33 0.3
34 0.28
35 0.28
36 0.36
37 0.41
38 0.45
39 0.47
40 0.51
41 0.52
42 0.56
43 0.6
44 0.55
45 0.49
46 0.46
47 0.45
48 0.4
49 0.35
50 0.31
51 0.27
52 0.26
53 0.27
54 0.31
55 0.33
56 0.33
57 0.38
58 0.46
59 0.52
60 0.59
61 0.67
62 0.69
63 0.75
64 0.81
65 0.87
66 0.87
67 0.87
68 0.84
69 0.85
70 0.8
71 0.73
72 0.65
73 0.54
74 0.43
75 0.34
76 0.26
77 0.16
78 0.1
79 0.07
80 0.06
81 0.06
82 0.05
83 0.06