Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YTA4

Protein Details
Accession R7YTA4    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-30SPFPTKFEDLSKKKQNRKLNKIDVIEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, mito_nucl 12.333, nucl 9.5, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MSSRSPFPTKFEDLSKKKQNRKLNKIDVIEMNWGRPLNENATRTLLSNTTQNNGVPASFTTWKKSHPRLKMTFAAPNDCFFELYVAAKAAAPVFPPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.71
4 0.75
5 0.8
6 0.82
7 0.82
8 0.86
9 0.86
10 0.86
11 0.85
12 0.78
13 0.73
14 0.65
15 0.56
16 0.52
17 0.42
18 0.32
19 0.26
20 0.23
21 0.2
22 0.2
23 0.19
24 0.17
25 0.23
26 0.23
27 0.22
28 0.25
29 0.25
30 0.23
31 0.23
32 0.18
33 0.13
34 0.16
35 0.15
36 0.14
37 0.14
38 0.13
39 0.13
40 0.12
41 0.11
42 0.08
43 0.08
44 0.11
45 0.15
46 0.16
47 0.2
48 0.21
49 0.27
50 0.34
51 0.43
52 0.48
53 0.52
54 0.6
55 0.61
56 0.66
57 0.67
58 0.63
59 0.6
60 0.54
61 0.52
62 0.44
63 0.4
64 0.37
65 0.31
66 0.27
67 0.21
68 0.2
69 0.14
70 0.15
71 0.14
72 0.12
73 0.12
74 0.11
75 0.12
76 0.11
77 0.11