Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7YT56

Protein Details
Accession R7YT56    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
232-259TGAYVRWVRRTRRHTNTRRMPMVRRVRVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, cysk 7, nucl 5, pero 3
Family & Domain DBs
Amino Acid Sequences MEDIEHVFAGAMNLLLVVQPCDKFPEGVYRAYAMRDGKPKSAYVMNPDGGAGKGNVVKWAEIKKEHKYVKYDDIGYWLPWKRLLGVPKKRSREQLLHDWWHAVAEARQHGRAAPTLSSVIDTYVESKRPANDEGAAAQSSFMTKPEESVLLPPDFHDTETRKNVAGRNPLDVSVVLERMHSLDRSVRVTKAQYTVLRNELAERFTSPPTLAELQNMREQYLEHRGRRPFDGTGAYVRWVRRTRRHTNTRRMPMVRRVRVLPVTADLANSLGVTLEQLQVMRDAFLPLLILNKPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.08
5 0.1
6 0.11
7 0.12
8 0.17
9 0.18
10 0.18
11 0.19
12 0.28
13 0.27
14 0.29
15 0.3
16 0.28
17 0.28
18 0.28
19 0.31
20 0.24
21 0.27
22 0.33
23 0.34
24 0.37
25 0.39
26 0.39
27 0.38
28 0.41
29 0.37
30 0.37
31 0.4
32 0.35
33 0.33
34 0.32
35 0.29
36 0.23
37 0.22
38 0.14
39 0.1
40 0.12
41 0.12
42 0.16
43 0.16
44 0.16
45 0.19
46 0.24
47 0.26
48 0.32
49 0.37
50 0.4
51 0.49
52 0.54
53 0.55
54 0.55
55 0.56
56 0.56
57 0.57
58 0.52
59 0.43
60 0.42
61 0.38
62 0.34
63 0.35
64 0.29
65 0.25
66 0.24
67 0.24
68 0.22
69 0.25
70 0.32
71 0.36
72 0.44
73 0.53
74 0.6
75 0.67
76 0.68
77 0.71
78 0.7
79 0.67
80 0.63
81 0.63
82 0.63
83 0.61
84 0.57
85 0.51
86 0.43
87 0.35
88 0.29
89 0.19
90 0.12
91 0.12
92 0.16
93 0.17
94 0.17
95 0.17
96 0.18
97 0.18
98 0.19
99 0.17
100 0.13
101 0.13
102 0.13
103 0.13
104 0.13
105 0.11
106 0.09
107 0.08
108 0.08
109 0.1
110 0.11
111 0.12
112 0.12
113 0.14
114 0.15
115 0.17
116 0.18
117 0.17
118 0.16
119 0.15
120 0.15
121 0.15
122 0.14
123 0.11
124 0.1
125 0.08
126 0.08
127 0.07
128 0.07
129 0.07
130 0.07
131 0.08
132 0.09
133 0.1
134 0.09
135 0.11
136 0.13
137 0.11
138 0.11
139 0.11
140 0.13
141 0.13
142 0.13
143 0.16
144 0.15
145 0.21
146 0.25
147 0.25
148 0.23
149 0.25
150 0.28
151 0.29
152 0.35
153 0.3
154 0.31
155 0.31
156 0.3
157 0.28
158 0.25
159 0.21
160 0.14
161 0.14
162 0.1
163 0.09
164 0.09
165 0.09
166 0.1
167 0.08
168 0.08
169 0.11
170 0.13
171 0.18
172 0.2
173 0.19
174 0.21
175 0.23
176 0.25
177 0.25
178 0.27
179 0.27
180 0.29
181 0.32
182 0.32
183 0.31
184 0.28
185 0.28
186 0.24
187 0.21
188 0.18
189 0.17
190 0.17
191 0.17
192 0.18
193 0.15
194 0.14
195 0.17
196 0.19
197 0.17
198 0.18
199 0.2
200 0.22
201 0.26
202 0.25
203 0.22
204 0.19
205 0.19
206 0.19
207 0.27
208 0.33
209 0.32
210 0.39
211 0.43
212 0.46
213 0.49
214 0.48
215 0.39
216 0.36
217 0.35
218 0.31
219 0.31
220 0.29
221 0.27
222 0.28
223 0.27
224 0.31
225 0.34
226 0.4
227 0.46
228 0.54
229 0.62
230 0.69
231 0.79
232 0.82
233 0.86
234 0.89
235 0.89
236 0.89
237 0.85
238 0.81
239 0.81
240 0.81
241 0.77
242 0.71
243 0.64
244 0.61
245 0.59
246 0.54
247 0.45
248 0.37
249 0.34
250 0.29
251 0.26
252 0.2
253 0.17
254 0.15
255 0.12
256 0.09
257 0.06
258 0.05
259 0.06
260 0.07
261 0.08
262 0.09
263 0.09
264 0.1
265 0.12
266 0.12
267 0.12
268 0.11
269 0.12
270 0.11
271 0.11
272 0.11
273 0.09
274 0.12