Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YY03

Protein Details
Accession R7YY03   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-36TTPSDTPDRKHSRPSRRRPPDSKLKAKLEEBasic
105-124VHGKCSVDHKHTPKPKPKPKBasic
NLS Segment(s)
PositionSequence
15-33RKHSRPSRRRPPDSKLKAK
116-124TPKPKPKPK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MNTGSATTPSDTPDRKHSRPSRRRPPDSKLKAKLEEHMKTTTEVLAKKLKAMQHFQLAKTPEERGSQEYPEELPYVTFLSVTCRVRVFRNSVAFAFNQQEPTFRVHGKCSVDHKHTPKPKPKPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.55
4 0.62
5 0.66
6 0.74
7 0.82
8 0.83
9 0.85
10 0.92
11 0.89
12 0.88
13 0.88
14 0.88
15 0.87
16 0.84
17 0.8
18 0.77
19 0.71
20 0.69
21 0.67
22 0.6
23 0.53
24 0.47
25 0.41
26 0.35
27 0.34
28 0.29
29 0.24
30 0.2
31 0.2
32 0.23
33 0.22
34 0.23
35 0.25
36 0.26
37 0.26
38 0.29
39 0.29
40 0.32
41 0.34
42 0.33
43 0.35
44 0.34
45 0.31
46 0.28
47 0.27
48 0.2
49 0.19
50 0.2
51 0.2
52 0.2
53 0.2
54 0.18
55 0.18
56 0.16
57 0.15
58 0.15
59 0.1
60 0.08
61 0.08
62 0.08
63 0.08
64 0.07
65 0.06
66 0.1
67 0.17
68 0.18
69 0.18
70 0.19
71 0.21
72 0.24
73 0.28
74 0.29
75 0.3
76 0.34
77 0.36
78 0.35
79 0.36
80 0.32
81 0.31
82 0.29
83 0.23
84 0.22
85 0.19
86 0.21
87 0.2
88 0.24
89 0.25
90 0.25
91 0.26
92 0.26
93 0.33
94 0.34
95 0.39
96 0.42
97 0.47
98 0.5
99 0.57
100 0.61
101 0.65
102 0.71
103 0.75
104 0.78