Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7Z4I6

Protein Details
Accession R7Z4I6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-108GKCGVDHKHTSKPKPKPTPKBasic
NLS Segment(s)
PositionSequence
100-108KPKPKPTPK
Subcellular Location(s) cyto 15, cyto_mito 11.833, cyto_nucl 8.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MEFAVHPAATTAPAPTSAFLSDFRSVLKLNGCGNLFGVDTINKGTWVEMKIGGASVVLPDKNTGGLDDDMYIPVTFAFDQQEPTFRVHGKCGVDHKHTSKPKPKPTPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.13
4 0.12
5 0.13
6 0.13
7 0.18
8 0.17
9 0.17
10 0.17
11 0.17
12 0.17
13 0.18
14 0.19
15 0.18
16 0.18
17 0.22
18 0.22
19 0.2
20 0.2
21 0.19
22 0.16
23 0.12
24 0.12
25 0.08
26 0.08
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.09
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.09
39 0.09
40 0.06
41 0.05
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.06
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.1
58 0.09
59 0.07
60 0.06
61 0.07
62 0.06
63 0.06
64 0.09
65 0.08
66 0.12
67 0.13
68 0.17
69 0.17
70 0.2
71 0.22
72 0.23
73 0.24
74 0.24
75 0.3
76 0.28
77 0.31
78 0.37
79 0.41
80 0.43
81 0.49
82 0.51
83 0.56
84 0.62
85 0.67
86 0.7
87 0.73
88 0.78