Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7YZS4

Protein Details
Accession R7YZS4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
105-136LLPLYASKPKQRRRSSRKERRPSKPMSPINESHydrophilic
NLS Segment(s)
PositionSequence
112-129KPKQRRRSSRKERRPSKP
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
Amino Acid Sequences MHFEISPSTSPSTPISIGFQTGSPVNTYQSSPSSQALSCAFPSWPTGSSLGRSSLGGFGSSAPSSFISDLDLIPDDLLDELDTSIPLLDAPPPPPREYLAVAAPLLPLYASKPKQRRRSSRKERRPSKPMSPINESPETPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.2
4 0.21
5 0.19
6 0.18
7 0.16
8 0.16
9 0.16
10 0.14
11 0.14
12 0.14
13 0.15
14 0.16
15 0.16
16 0.17
17 0.19
18 0.2
19 0.21
20 0.21
21 0.19
22 0.21
23 0.21
24 0.2
25 0.18
26 0.17
27 0.15
28 0.13
29 0.16
30 0.14
31 0.14
32 0.13
33 0.15
34 0.14
35 0.16
36 0.17
37 0.17
38 0.15
39 0.15
40 0.14
41 0.13
42 0.12
43 0.11
44 0.09
45 0.08
46 0.09
47 0.09
48 0.08
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.08
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.06
76 0.07
77 0.1
78 0.16
79 0.18
80 0.2
81 0.21
82 0.22
83 0.23
84 0.24
85 0.24
86 0.2
87 0.2
88 0.18
89 0.18
90 0.16
91 0.13
92 0.1
93 0.07
94 0.06
95 0.07
96 0.16
97 0.2
98 0.28
99 0.38
100 0.48
101 0.59
102 0.69
103 0.77
104 0.79
105 0.87
106 0.9
107 0.92
108 0.94
109 0.95
110 0.95
111 0.93
112 0.92
113 0.89
114 0.88
115 0.88
116 0.84
117 0.81
118 0.79
119 0.74
120 0.72
121 0.69