Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z6C8

Protein Details
Accession R7Z6C8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRQTRRKHKRLCLERSSNSRSKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
CDD cd09917  F-box_SF  
Amino Acid Sequences MRQTRRKHKRLCLERSSNSRSKQEKTSPPSPPPAESDPYRHHPAQQPPPKHLLAQDHVPASARVFGTFELLEIILSNLSAWDVMHLQRVCTRWRDTVQGSVPLRRRVDEVHEMRKILVLLCRRADEEAGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.83
4 0.79
5 0.74
6 0.73
7 0.68
8 0.63
9 0.64
10 0.64
11 0.65
12 0.66
13 0.7
14 0.68
15 0.67
16 0.71
17 0.64
18 0.57
19 0.53
20 0.49
21 0.45
22 0.4
23 0.42
24 0.39
25 0.43
26 0.47
27 0.41
28 0.41
29 0.44
30 0.51
31 0.55
32 0.58
33 0.55
34 0.53
35 0.58
36 0.54
37 0.48
38 0.41
39 0.36
40 0.3
41 0.3
42 0.29
43 0.24
44 0.23
45 0.23
46 0.2
47 0.15
48 0.15
49 0.11
50 0.09
51 0.09
52 0.09
53 0.1
54 0.09
55 0.09
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.03
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.05
70 0.06
71 0.13
72 0.13
73 0.14
74 0.17
75 0.19
76 0.21
77 0.25
78 0.28
79 0.27
80 0.29
81 0.35
82 0.33
83 0.39
84 0.39
85 0.43
86 0.41
87 0.43
88 0.47
89 0.48
90 0.47
91 0.4
92 0.4
93 0.34
94 0.39
95 0.43
96 0.44
97 0.46
98 0.48
99 0.47
100 0.45
101 0.44
102 0.38
103 0.29
104 0.28
105 0.26
106 0.28
107 0.31
108 0.33
109 0.32
110 0.33
111 0.32