Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YZF0

Protein Details
Accession R7YZF0   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
119-140DYEYEVTKKQPKKARRAKKVEEBasic
NLS Segment(s)
PositionSequence
34-57AKTKPKGKGKIPGPPRSPINRRAR
126-138KKQPKKARRAKKV
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MAPKQPAPRRSTRSTKGKVPERLVSDPTTTFKVAKTKPKGKGKIPGPPRSPINRRARGLEEVRWLELMVVEDFDEEGEWDEEGPWDDEMEEMGGWDGDVAVERKEQVKKEESDDEDEEDYEYEVTKKQPKKARRAKKVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.77
4 0.79
5 0.79
6 0.75
7 0.72
8 0.68
9 0.66
10 0.6
11 0.53
12 0.46
13 0.39
14 0.36
15 0.32
16 0.27
17 0.23
18 0.23
19 0.29
20 0.32
21 0.4
22 0.48
23 0.53
24 0.61
25 0.71
26 0.75
27 0.72
28 0.76
29 0.72
30 0.71
31 0.71
32 0.71
33 0.64
34 0.62
35 0.62
36 0.61
37 0.61
38 0.61
39 0.63
40 0.61
41 0.59
42 0.58
43 0.56
44 0.54
45 0.52
46 0.45
47 0.41
48 0.34
49 0.33
50 0.29
51 0.25
52 0.18
53 0.16
54 0.13
55 0.07
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.03
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.06
70 0.07
71 0.06
72 0.06
73 0.06
74 0.05
75 0.06
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.02
85 0.04
86 0.05
87 0.06
88 0.06
89 0.07
90 0.13
91 0.17
92 0.2
93 0.24
94 0.3
95 0.32
96 0.36
97 0.43
98 0.42
99 0.44
100 0.43
101 0.41
102 0.35
103 0.33
104 0.28
105 0.21
106 0.18
107 0.12
108 0.11
109 0.09
110 0.1
111 0.15
112 0.24
113 0.29
114 0.37
115 0.47
116 0.56
117 0.66
118 0.75
119 0.81
120 0.84