Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YXZ5

Protein Details
Accession R7YXZ5   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-97QKNRDFRDEGRRKRQKNGLPBasic
311-333AENEREKKARSRSREPDHRDSDRBasic
340-372YDDKEENYRRGKERRRKDRDRSRDRDHDRGRDYBasic
384-422RSSSVESKHRSRKQDDRHDRKDKERRRYDKQDRNEGGSSBasic
NLS Segment(s)
PositionSequence
270-275KGPRRK
316-413EKKARSRSREPDHRDSDRSSRRNRYDDKEENYRRGKERRRKDRDRSRDRDHDRGRDYDDRRHKPSGRDRSSSVESKHRSRKQDDRHDRKDKERRRYDK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003676  F:nucleic acid binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MTDIKAAPKFSLALGAKRAPPSQVSKAKRPHSSLQDSDDEDAGHVQPQEVSHFDQLAGGAIGANDNRQAKGPLVIQSQKNRDFRDEGRRKRQKNGLPAEAQAARANGVVTKEPNGAGSLQPFGLTVVEKVTVEDPQTANSEGANGASPTTTAPIKQKTDDELALEALTGNKLQSNLVLPAISEEEAFQRDYKNAPDMATLEQYAAVPVEEFGAALLRGMGWKDGEAIGKRRGQQAVQARVPERRPALLGIGAKSEAAVGIELGAWGKADKGPRRKKDQTYTPVVLRNKKTGEQLTEEELKAKLEEQKLVVAENEREKKARSRSREPDHRDSDRSSRRNRYDDKEENYRRGKERRRKDRDRSRDRDHDRGRDYDDRRHKPSGRDRSSSVESKHRSRKQDDRHDRKDKERRRYDKQDRNEGGSSRRHHYERDYNQDRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.39
4 0.42
5 0.43
6 0.36
7 0.39
8 0.42
9 0.46
10 0.51
11 0.54
12 0.59
13 0.67
14 0.73
15 0.76
16 0.75
17 0.74
18 0.74
19 0.76
20 0.71
21 0.68
22 0.65
23 0.6
24 0.55
25 0.46
26 0.36
27 0.28
28 0.25
29 0.19
30 0.16
31 0.14
32 0.12
33 0.13
34 0.14
35 0.16
36 0.17
37 0.19
38 0.19
39 0.19
40 0.19
41 0.18
42 0.17
43 0.16
44 0.13
45 0.09
46 0.08
47 0.07
48 0.08
49 0.08
50 0.08
51 0.11
52 0.13
53 0.13
54 0.15
55 0.16
56 0.16
57 0.2
58 0.23
59 0.25
60 0.3
61 0.36
62 0.41
63 0.48
64 0.55
65 0.59
66 0.62
67 0.59
68 0.57
69 0.56
70 0.56
71 0.59
72 0.61
73 0.63
74 0.68
75 0.76
76 0.75
77 0.78
78 0.81
79 0.78
80 0.78
81 0.76
82 0.73
83 0.66
84 0.63
85 0.59
86 0.51
87 0.45
88 0.35
89 0.27
90 0.19
91 0.17
92 0.16
93 0.12
94 0.12
95 0.13
96 0.13
97 0.15
98 0.16
99 0.15
100 0.16
101 0.15
102 0.15
103 0.13
104 0.14
105 0.12
106 0.11
107 0.11
108 0.1
109 0.09
110 0.09
111 0.08
112 0.07
113 0.07
114 0.08
115 0.08
116 0.09
117 0.09
118 0.1
119 0.11
120 0.14
121 0.13
122 0.14
123 0.16
124 0.16
125 0.15
126 0.14
127 0.13
128 0.1
129 0.1
130 0.09
131 0.07
132 0.06
133 0.06
134 0.06
135 0.06
136 0.08
137 0.07
138 0.09
139 0.14
140 0.2
141 0.23
142 0.25
143 0.26
144 0.28
145 0.32
146 0.3
147 0.26
148 0.21
149 0.19
150 0.17
151 0.15
152 0.11
153 0.07
154 0.07
155 0.06
156 0.05
157 0.05
158 0.06
159 0.06
160 0.07
161 0.08
162 0.09
163 0.09
164 0.09
165 0.08
166 0.09
167 0.1
168 0.09
169 0.07
170 0.06
171 0.07
172 0.08
173 0.09
174 0.09
175 0.09
176 0.1
177 0.11
178 0.12
179 0.14
180 0.14
181 0.13
182 0.14
183 0.15
184 0.15
185 0.15
186 0.14
187 0.11
188 0.1
189 0.09
190 0.08
191 0.07
192 0.05
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.03
199 0.04
200 0.04
201 0.04
202 0.03
203 0.03
204 0.03
205 0.03
206 0.04
207 0.04
208 0.04
209 0.05
210 0.06
211 0.08
212 0.1
213 0.14
214 0.17
215 0.21
216 0.22
217 0.25
218 0.26
219 0.24
220 0.29
221 0.34
222 0.38
223 0.37
224 0.38
225 0.36
226 0.39
227 0.4
228 0.38
229 0.3
230 0.23
231 0.22
232 0.19
233 0.19
234 0.18
235 0.19
236 0.15
237 0.15
238 0.14
239 0.13
240 0.12
241 0.1
242 0.06
243 0.05
244 0.04
245 0.03
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.04
254 0.06
255 0.12
256 0.19
257 0.3
258 0.4
259 0.48
260 0.58
261 0.66
262 0.72
263 0.76
264 0.79
265 0.77
266 0.75
267 0.72
268 0.66
269 0.65
270 0.61
271 0.6
272 0.52
273 0.5
274 0.45
275 0.44
276 0.46
277 0.43
278 0.41
279 0.38
280 0.37
281 0.36
282 0.37
283 0.34
284 0.3
285 0.25
286 0.22
287 0.18
288 0.17
289 0.19
290 0.17
291 0.19
292 0.19
293 0.22
294 0.21
295 0.22
296 0.21
297 0.18
298 0.19
299 0.25
300 0.29
301 0.28
302 0.29
303 0.31
304 0.37
305 0.45
306 0.51
307 0.51
308 0.56
309 0.65
310 0.75
311 0.83
312 0.84
313 0.83
314 0.83
315 0.8
316 0.74
317 0.68
318 0.68
319 0.68
320 0.67
321 0.66
322 0.68
323 0.69
324 0.74
325 0.76
326 0.74
327 0.74
328 0.75
329 0.73
330 0.74
331 0.72
332 0.72
333 0.72
334 0.71
335 0.68
336 0.69
337 0.73
338 0.72
339 0.78
340 0.8
341 0.84
342 0.88
343 0.92
344 0.93
345 0.93
346 0.94
347 0.92
348 0.91
349 0.91
350 0.87
351 0.87
352 0.84
353 0.82
354 0.76
355 0.71
356 0.69
357 0.67
358 0.65
359 0.64
360 0.66
361 0.65
362 0.66
363 0.71
364 0.7
365 0.7
366 0.76
367 0.77
368 0.75
369 0.72
370 0.69
371 0.68
372 0.69
373 0.65
374 0.59
375 0.58
376 0.56
377 0.6
378 0.68
379 0.68
380 0.7
381 0.71
382 0.77
383 0.78
384 0.84
385 0.85
386 0.85
387 0.88
388 0.91
389 0.89
390 0.9
391 0.9
392 0.88
393 0.88
394 0.88
395 0.86
396 0.86
397 0.91
398 0.91
399 0.9
400 0.9
401 0.91
402 0.85
403 0.83
404 0.78
405 0.71
406 0.66
407 0.64
408 0.59
409 0.54
410 0.57
411 0.52
412 0.5
413 0.56
414 0.6
415 0.61
416 0.67
417 0.7