Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YYZ2

Protein Details
Accession R7YYZ2   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-41QQPTKKTRAASARNIRKIRKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 13.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MAVTRSQTSKKRSRLDAGAADQQPTKKTRAASARNIRKIRKTECDLTDGDLSAPSQPVPLPKESAKTTKPGNPLMRLPGELRNEIYRLVLVSNNQLLVTKSSIPTQPPLTMVSHQIRKEAIAIFYHENKFGVEVVNNDGSHEGVWLAKIGRENTNLLDFSRVHEDYYIFLFSQNSTDPWTNLLQWLKDFYHYKAGSPGSGPIRGNRMRPISVLVLLFNAAEKLRKAKTSWETAEHVLTIMGEVAECKRPNWKPKIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.71
4 0.67
5 0.67
6 0.59
7 0.54
8 0.5
9 0.45
10 0.41
11 0.36
12 0.34
13 0.29
14 0.29
15 0.36
16 0.43
17 0.49
18 0.55
19 0.63
20 0.7
21 0.76
22 0.82
23 0.8
24 0.78
25 0.78
26 0.75
27 0.73
28 0.7
29 0.69
30 0.64
31 0.63
32 0.55
33 0.5
34 0.45
35 0.35
36 0.28
37 0.2
38 0.18
39 0.14
40 0.14
41 0.1
42 0.09
43 0.09
44 0.14
45 0.17
46 0.18
47 0.21
48 0.23
49 0.28
50 0.31
51 0.37
52 0.34
53 0.35
54 0.38
55 0.4
56 0.43
57 0.47
58 0.48
59 0.45
60 0.46
61 0.47
62 0.43
63 0.39
64 0.36
65 0.34
66 0.32
67 0.29
68 0.28
69 0.25
70 0.24
71 0.22
72 0.2
73 0.14
74 0.11
75 0.11
76 0.1
77 0.09
78 0.11
79 0.11
80 0.11
81 0.11
82 0.11
83 0.11
84 0.11
85 0.12
86 0.11
87 0.11
88 0.13
89 0.15
90 0.15
91 0.18
92 0.18
93 0.17
94 0.17
95 0.18
96 0.18
97 0.17
98 0.21
99 0.23
100 0.27
101 0.26
102 0.26
103 0.24
104 0.23
105 0.24
106 0.2
107 0.16
108 0.11
109 0.13
110 0.14
111 0.18
112 0.18
113 0.17
114 0.15
115 0.14
116 0.14
117 0.12
118 0.1
119 0.07
120 0.07
121 0.1
122 0.12
123 0.12
124 0.12
125 0.11
126 0.11
127 0.1
128 0.09
129 0.06
130 0.04
131 0.04
132 0.05
133 0.05
134 0.06
135 0.09
136 0.11
137 0.13
138 0.15
139 0.16
140 0.16
141 0.19
142 0.18
143 0.16
144 0.17
145 0.14
146 0.15
147 0.2
148 0.18
149 0.16
150 0.17
151 0.17
152 0.15
153 0.17
154 0.16
155 0.1
156 0.1
157 0.1
158 0.1
159 0.11
160 0.11
161 0.1
162 0.13
163 0.14
164 0.13
165 0.15
166 0.17
167 0.15
168 0.19
169 0.21
170 0.18
171 0.18
172 0.21
173 0.2
174 0.23
175 0.25
176 0.23
177 0.3
178 0.3
179 0.3
180 0.32
181 0.32
182 0.28
183 0.26
184 0.3
185 0.23
186 0.27
187 0.27
188 0.24
189 0.32
190 0.34
191 0.36
192 0.37
193 0.39
194 0.36
195 0.36
196 0.37
197 0.31
198 0.31
199 0.28
200 0.22
201 0.17
202 0.16
203 0.15
204 0.11
205 0.1
206 0.08
207 0.09
208 0.11
209 0.16
210 0.19
211 0.22
212 0.24
213 0.32
214 0.38
215 0.46
216 0.49
217 0.49
218 0.5
219 0.49
220 0.49
221 0.4
222 0.33
223 0.24
224 0.19
225 0.14
226 0.1
227 0.07
228 0.05
229 0.06
230 0.09
231 0.16
232 0.17
233 0.18
234 0.27
235 0.35
236 0.46