Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0D3F8

Protein Details
Accession B0D3F8    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAIHIKKLKVRQRKGQPNHSITSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 11.833, nucl 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG lbc:LACBIDRAFT_315900  -  
Amino Acid Sequences MAIHIKKLKVRQRKGQPNHSITSTHFDPASSCTCLAAATVMCAPQLSAMLGCWAATNDIHSIGKCQEDAEKLFQCMRTTPMPKKIHKPTINYHLARLGKTIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.88
4 0.83
5 0.78
6 0.7
7 0.61
8 0.51
9 0.49
10 0.4
11 0.31
12 0.25
13 0.21
14 0.2
15 0.21
16 0.23
17 0.17
18 0.16
19 0.14
20 0.14
21 0.14
22 0.13
23 0.11
24 0.07
25 0.06
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.06
44 0.06
45 0.07
46 0.08
47 0.08
48 0.1
49 0.1
50 0.11
51 0.1
52 0.1
53 0.11
54 0.14
55 0.16
56 0.2
57 0.21
58 0.22
59 0.24
60 0.26
61 0.24
62 0.23
63 0.24
64 0.26
65 0.32
66 0.37
67 0.45
68 0.51
69 0.55
70 0.64
71 0.7
72 0.73
73 0.73
74 0.73
75 0.71
76 0.73
77 0.78
78 0.69
79 0.61
80 0.59
81 0.55
82 0.49