Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7YPZ9

Protein Details
Accession R7YPZ9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-89WSQKHQPYSKRKHARNSLRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015257  Maf1  
IPR038564  Maf1_sf  
Gene Ontology GO:0016480  P:negative regulation of transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF09174  Maf1  
Amino Acid Sequences MWRLIDNEMSLRECAAYCYSPEEDPFDGEENAIWSLHYFLFNKERKRVCYIYLRGLSVISHSPVRTTSAWSQKHQPYSKRKHARNSLRISEGATKRARYWLGDDAEVEDAADDDDEVIHDPGDDEVDADEYPDIREASVSSYLTDDDDYDMELRVHREKSAVRGVSEHIADSMEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.15
5 0.19
6 0.21
7 0.21
8 0.22
9 0.24
10 0.21
11 0.22
12 0.23
13 0.21
14 0.19
15 0.18
16 0.17
17 0.14
18 0.14
19 0.12
20 0.1
21 0.07
22 0.09
23 0.1
24 0.12
25 0.12
26 0.15
27 0.24
28 0.3
29 0.35
30 0.42
31 0.46
32 0.48
33 0.54
34 0.53
35 0.48
36 0.53
37 0.51
38 0.52
39 0.49
40 0.46
41 0.39
42 0.37
43 0.32
44 0.24
45 0.21
46 0.13
47 0.12
48 0.11
49 0.12
50 0.12
51 0.16
52 0.14
53 0.17
54 0.22
55 0.3
56 0.34
57 0.35
58 0.43
59 0.44
60 0.52
61 0.53
62 0.55
63 0.56
64 0.62
65 0.71
66 0.72
67 0.73
68 0.74
69 0.79
70 0.81
71 0.8
72 0.77
73 0.7
74 0.63
75 0.58
76 0.5
77 0.48
78 0.39
79 0.35
80 0.3
81 0.27
82 0.25
83 0.29
84 0.27
85 0.2
86 0.22
87 0.23
88 0.23
89 0.23
90 0.22
91 0.2
92 0.2
93 0.18
94 0.14
95 0.08
96 0.06
97 0.05
98 0.05
99 0.03
100 0.02
101 0.03
102 0.03
103 0.04
104 0.05
105 0.04
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.05
112 0.05
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.08
120 0.08
121 0.07
122 0.07
123 0.07
124 0.1
125 0.14
126 0.13
127 0.12
128 0.13
129 0.13
130 0.14
131 0.14
132 0.11
133 0.09
134 0.09
135 0.1
136 0.1
137 0.1
138 0.1
139 0.11
140 0.14
141 0.18
142 0.19
143 0.18
144 0.22
145 0.24
146 0.3
147 0.38
148 0.38
149 0.34
150 0.35
151 0.37
152 0.38
153 0.36
154 0.3
155 0.21