Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z4R2

Protein Details
Accession R7Z4R2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
324-346AGKVRVSRESRPRRGRGQAESAKHydrophilic
NLS Segment(s)
PositionSequence
331-339RESRPRRGR
Subcellular Location(s) mito 9cyto 9cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MAGVFDLPIVGPIIKNGVSTVVSGAVTAAGGYAGDLVIGAGNLVEQGGRTVGNGVSGFIGSYGEKINQYGNTVIAATAPGGPPVIDTVQKTAKQVSHTATNVTNRASNTASGVAKTAQKSLPAPVSNAQKTITNTATSATKALPSTVGGAQKAITGTASSATKALPSSVGGALGAPKPASSAVQKKAYEPYKPATSYKGFDSKSAAGTPAQYKPPTPGAPKPPAERKYEPYKPATSYKPFDSKSAAGTPAEFKPGGGYKSPAERAKEAGVGTGGYKPPNVGTAVGGAKSYAGAAAKPVGAATGAATGAARGLVGGAVGGAQNAAGKVRVSRESRPRRGRGQAESAKPAPQFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.13
5 0.13
6 0.14
7 0.14
8 0.13
9 0.12
10 0.12
11 0.11
12 0.09
13 0.08
14 0.07
15 0.06
16 0.03
17 0.03
18 0.03
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.05
35 0.05
36 0.06
37 0.08
38 0.08
39 0.11
40 0.11
41 0.11
42 0.11
43 0.1
44 0.1
45 0.08
46 0.09
47 0.06
48 0.08
49 0.09
50 0.1
51 0.1
52 0.11
53 0.14
54 0.14
55 0.16
56 0.16
57 0.15
58 0.14
59 0.13
60 0.12
61 0.1
62 0.09
63 0.07
64 0.08
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.09
71 0.1
72 0.1
73 0.11
74 0.16
75 0.21
76 0.23
77 0.24
78 0.26
79 0.28
80 0.28
81 0.32
82 0.3
83 0.31
84 0.31
85 0.32
86 0.32
87 0.33
88 0.32
89 0.29
90 0.29
91 0.22
92 0.24
93 0.23
94 0.19
95 0.17
96 0.19
97 0.18
98 0.15
99 0.16
100 0.15
101 0.18
102 0.19
103 0.2
104 0.17
105 0.19
106 0.19
107 0.22
108 0.26
109 0.23
110 0.24
111 0.26
112 0.33
113 0.32
114 0.32
115 0.29
116 0.27
117 0.27
118 0.3
119 0.26
120 0.19
121 0.18
122 0.18
123 0.18
124 0.15
125 0.15
126 0.11
127 0.11
128 0.1
129 0.11
130 0.1
131 0.09
132 0.11
133 0.13
134 0.14
135 0.12
136 0.13
137 0.12
138 0.13
139 0.12
140 0.1
141 0.07
142 0.05
143 0.05
144 0.07
145 0.07
146 0.06
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.06
153 0.06
154 0.08
155 0.07
156 0.07
157 0.07
158 0.06
159 0.08
160 0.08
161 0.08
162 0.05
163 0.05
164 0.06
165 0.06
166 0.07
167 0.1
168 0.16
169 0.2
170 0.27
171 0.28
172 0.29
173 0.36
174 0.38
175 0.37
176 0.33
177 0.33
178 0.31
179 0.33
180 0.32
181 0.3
182 0.29
183 0.29
184 0.29
185 0.33
186 0.28
187 0.27
188 0.3
189 0.26
190 0.25
191 0.24
192 0.22
193 0.15
194 0.17
195 0.19
196 0.18
197 0.21
198 0.19
199 0.19
200 0.21
201 0.27
202 0.28
203 0.3
204 0.33
205 0.37
206 0.44
207 0.48
208 0.51
209 0.55
210 0.55
211 0.58
212 0.56
213 0.54
214 0.56
215 0.6
216 0.58
217 0.54
218 0.53
219 0.5
220 0.51
221 0.52
222 0.49
223 0.45
224 0.45
225 0.48
226 0.46
227 0.44
228 0.42
229 0.37
230 0.34
231 0.34
232 0.3
233 0.22
234 0.23
235 0.24
236 0.2
237 0.22
238 0.18
239 0.15
240 0.17
241 0.2
242 0.2
243 0.19
244 0.2
245 0.19
246 0.26
247 0.32
248 0.33
249 0.33
250 0.33
251 0.34
252 0.34
253 0.35
254 0.28
255 0.23
256 0.19
257 0.16
258 0.15
259 0.17
260 0.16
261 0.14
262 0.14
263 0.13
264 0.13
265 0.15
266 0.15
267 0.11
268 0.11
269 0.14
270 0.16
271 0.16
272 0.15
273 0.13
274 0.12
275 0.11
276 0.1
277 0.07
278 0.06
279 0.06
280 0.07
281 0.09
282 0.09
283 0.09
284 0.09
285 0.08
286 0.07
287 0.07
288 0.07
289 0.07
290 0.06
291 0.06
292 0.06
293 0.06
294 0.06
295 0.06
296 0.05
297 0.03
298 0.03
299 0.03
300 0.03
301 0.03
302 0.03
303 0.03
304 0.04
305 0.04
306 0.03
307 0.03
308 0.05
309 0.05
310 0.06
311 0.07
312 0.08
313 0.1
314 0.15
315 0.23
316 0.27
317 0.36
318 0.47
319 0.57
320 0.67
321 0.75
322 0.78
323 0.79
324 0.84
325 0.83
326 0.8
327 0.8
328 0.78
329 0.75
330 0.76
331 0.69
332 0.65