Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YMP3

Protein Details
Accession R7YMP3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
154-178AFDMRKPLSRDKGRKHVRERGEDVRBasic
NLS Segment(s)
PositionSequence
167-167R
Subcellular Location(s) nucl 10.5, cyto_nucl 9, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF13673  Acetyltransf_10  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MAHVRPMRATDLFKFNQCNLDPLTETYNIGFYLEYLIKWPHLCNAANNLTVLAKLEASPYPAPVQPYSPDTNPNPNYLPWHGHITALTIAPKARRLGHATRLTQSLEQACDAADAWFVDLFVRAENKVAQELYRKMGYSVYRRIVGYYNDDADAFDMRKPLSRDKGRKHVRERGEDVRVDPAEVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.44
4 0.4
5 0.39
6 0.32
7 0.33
8 0.3
9 0.28
10 0.3
11 0.24
12 0.24
13 0.21
14 0.2
15 0.16
16 0.14
17 0.12
18 0.08
19 0.11
20 0.11
21 0.11
22 0.12
23 0.13
24 0.15
25 0.16
26 0.16
27 0.15
28 0.2
29 0.21
30 0.21
31 0.28
32 0.3
33 0.29
34 0.29
35 0.26
36 0.21
37 0.19
38 0.18
39 0.11
40 0.08
41 0.07
42 0.09
43 0.08
44 0.12
45 0.13
46 0.13
47 0.15
48 0.16
49 0.18
50 0.17
51 0.18
52 0.16
53 0.21
54 0.23
55 0.22
56 0.25
57 0.25
58 0.34
59 0.33
60 0.34
61 0.31
62 0.28
63 0.31
64 0.28
65 0.29
66 0.21
67 0.25
68 0.22
69 0.21
70 0.21
71 0.18
72 0.17
73 0.15
74 0.14
75 0.09
76 0.1
77 0.1
78 0.12
79 0.12
80 0.12
81 0.14
82 0.19
83 0.23
84 0.31
85 0.37
86 0.36
87 0.37
88 0.37
89 0.36
90 0.3
91 0.28
92 0.21
93 0.15
94 0.14
95 0.12
96 0.1
97 0.09
98 0.09
99 0.07
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.08
110 0.07
111 0.08
112 0.1
113 0.11
114 0.11
115 0.12
116 0.12
117 0.17
118 0.19
119 0.21
120 0.22
121 0.21
122 0.2
123 0.24
124 0.28
125 0.28
126 0.34
127 0.34
128 0.35
129 0.35
130 0.36
131 0.35
132 0.33
133 0.32
134 0.29
135 0.26
136 0.24
137 0.24
138 0.22
139 0.2
140 0.2
141 0.15
142 0.13
143 0.13
144 0.13
145 0.19
146 0.22
147 0.29
148 0.37
149 0.47
150 0.56
151 0.63
152 0.74
153 0.79
154 0.85
155 0.86
156 0.85
157 0.84
158 0.83
159 0.81
160 0.79
161 0.76
162 0.68
163 0.61
164 0.6
165 0.51