Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YX03

Protein Details
Accession R7YX03   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-47VEPQEKKKVPKGRAKKRIQYTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
14-38VKSQTPKVEPQEKKKVPKGRAKKRI
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKVPKGRAKKRIQYTRRFVNVTMTGGKRKVRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.45
4 0.46
5 0.48
6 0.57
7 0.59
8 0.64
9 0.64
10 0.65
11 0.68
12 0.69
13 0.71
14 0.7
15 0.71
16 0.68
17 0.72
18 0.75
19 0.74
20 0.79
21 0.81
22 0.82
23 0.84
24 0.87
25 0.86
26 0.85
27 0.82
28 0.82
29 0.79
30 0.72
31 0.62
32 0.6
33 0.54
34 0.48
35 0.46
36 0.4
37 0.39
38 0.41