Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YUR8

Protein Details
Accession R7YUR8   
Localization Confidence High
Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-33DEPAEPLFRPSKRRKVFRKRLHDDDTAIHydrophilic
234-263SKKIRLGRDGKPWRGRKRRNSEDIKRDQLVBasic
NLS Segment(s)
PositionSequence
16-24SKRRKVFRK
81-90RRRKLGKARR
235-253KKIRLGRDGKPWRGRKRRN
320-354TAGKGEVQARGPKLGGSRSARAAMRALEEKAAKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010756  Tls1-like  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF07052  Hep_59  
Amino Acid Sequences MANIEDEPAEPLFRPSKRRKVFRKRLHDDDTAIAQAPPTSTASVITAEERVVPATTKIAETNEQGPARAPEADLSVAEILRRRKLGKARRGGIEFSNAAQAQRSMSETPQSSNALVVVDQERSVLDVAAGRFAPQTGQRADVLDKHMMAYVDSKMTALREGASASQSSSQTANLTDTIRLPSGAPGQKQAASLGKLHEIDLGSDATMRNIARTEAAFRKLETGDLVEVEDIDTSKKIRLGRDGKPWRGRKRRNSEDIKRDQLVEEVLKESRLDLYDEPEASVSNGDNQAADDLIAERFRQEFMEQIRNNNVRRTQPKPPTAGKGEVQARGPKLGGSRSARAAMRALEEKAAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.55
4 0.63
5 0.74
6 0.8
7 0.85
8 0.91
9 0.92
10 0.93
11 0.91
12 0.91
13 0.88
14 0.82
15 0.74
16 0.67
17 0.6
18 0.5
19 0.42
20 0.32
21 0.25
22 0.21
23 0.18
24 0.15
25 0.13
26 0.12
27 0.11
28 0.12
29 0.13
30 0.13
31 0.14
32 0.13
33 0.12
34 0.12
35 0.13
36 0.12
37 0.12
38 0.11
39 0.11
40 0.1
41 0.12
42 0.13
43 0.13
44 0.14
45 0.16
46 0.18
47 0.2
48 0.23
49 0.28
50 0.27
51 0.26
52 0.26
53 0.25
54 0.24
55 0.22
56 0.19
57 0.13
58 0.15
59 0.15
60 0.13
61 0.13
62 0.12
63 0.11
64 0.12
65 0.15
66 0.16
67 0.19
68 0.22
69 0.22
70 0.28
71 0.38
72 0.48
73 0.53
74 0.6
75 0.62
76 0.66
77 0.68
78 0.63
79 0.55
80 0.51
81 0.41
82 0.32
83 0.31
84 0.25
85 0.22
86 0.19
87 0.18
88 0.13
89 0.13
90 0.15
91 0.11
92 0.12
93 0.17
94 0.17
95 0.18
96 0.21
97 0.21
98 0.18
99 0.17
100 0.17
101 0.12
102 0.11
103 0.12
104 0.1
105 0.09
106 0.09
107 0.09
108 0.08
109 0.08
110 0.09
111 0.07
112 0.05
113 0.08
114 0.08
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.1
121 0.1
122 0.14
123 0.13
124 0.15
125 0.15
126 0.17
127 0.18
128 0.19
129 0.2
130 0.17
131 0.16
132 0.15
133 0.16
134 0.14
135 0.14
136 0.12
137 0.1
138 0.09
139 0.09
140 0.09
141 0.08
142 0.08
143 0.08
144 0.07
145 0.06
146 0.06
147 0.07
148 0.07
149 0.08
150 0.07
151 0.07
152 0.1
153 0.1
154 0.1
155 0.1
156 0.1
157 0.1
158 0.1
159 0.11
160 0.09
161 0.1
162 0.09
163 0.1
164 0.11
165 0.1
166 0.1
167 0.09
168 0.09
169 0.15
170 0.17
171 0.17
172 0.18
173 0.19
174 0.2
175 0.2
176 0.2
177 0.16
178 0.15
179 0.16
180 0.15
181 0.16
182 0.15
183 0.15
184 0.15
185 0.13
186 0.11
187 0.12
188 0.11
189 0.08
190 0.08
191 0.08
192 0.06
193 0.08
194 0.08
195 0.07
196 0.08
197 0.08
198 0.08
199 0.09
200 0.14
201 0.16
202 0.2
203 0.2
204 0.19
205 0.22
206 0.21
207 0.21
208 0.17
209 0.15
210 0.11
211 0.11
212 0.11
213 0.07
214 0.07
215 0.07
216 0.06
217 0.05
218 0.05
219 0.06
220 0.06
221 0.08
222 0.11
223 0.14
224 0.16
225 0.26
226 0.32
227 0.38
228 0.48
229 0.56
230 0.62
231 0.69
232 0.76
233 0.77
234 0.81
235 0.85
236 0.85
237 0.87
238 0.88
239 0.89
240 0.9
241 0.89
242 0.89
243 0.87
244 0.83
245 0.73
246 0.64
247 0.54
248 0.45
249 0.38
250 0.29
251 0.22
252 0.17
253 0.16
254 0.16
255 0.15
256 0.14
257 0.13
258 0.13
259 0.14
260 0.12
261 0.16
262 0.19
263 0.19
264 0.19
265 0.17
266 0.17
267 0.14
268 0.14
269 0.11
270 0.11
271 0.12
272 0.11
273 0.11
274 0.11
275 0.12
276 0.11
277 0.1
278 0.07
279 0.07
280 0.08
281 0.09
282 0.09
283 0.09
284 0.1
285 0.11
286 0.12
287 0.11
288 0.16
289 0.21
290 0.32
291 0.32
292 0.36
293 0.45
294 0.5
295 0.52
296 0.53
297 0.53
298 0.52
299 0.58
300 0.6
301 0.61
302 0.65
303 0.7
304 0.7
305 0.71
306 0.7
307 0.69
308 0.68
309 0.59
310 0.58
311 0.56
312 0.52
313 0.5
314 0.48
315 0.44
316 0.41
317 0.39
318 0.33
319 0.31
320 0.31
321 0.35
322 0.35
323 0.38
324 0.39
325 0.45
326 0.43
327 0.41
328 0.4
329 0.34
330 0.34
331 0.34
332 0.31
333 0.31
334 0.35