Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DKB0

Protein Details
Accession B0DKB0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-46KVKSQTPKVEKQEKKKTPKGRAKKRILYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
12-38GKVKSQTPKVEKQEKKKTPKGRAKKRI
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lbc:LACBIDRAFT_303783  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRILYNRRFVNVTTLPGGKRRMNPNPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.71
9 0.72
10 0.74
11 0.78
12 0.78
13 0.81
14 0.81
15 0.81
16 0.81
17 0.85
18 0.85
19 0.85
20 0.87
21 0.87
22 0.87
23 0.87
24 0.87
25 0.87
26 0.84
27 0.82
28 0.79
29 0.72
30 0.65
31 0.56
32 0.53
33 0.45
34 0.4
35 0.34
36 0.3
37 0.28
38 0.31
39 0.36
40 0.34
41 0.39
42 0.45
43 0.52