Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DGI8

Protein Details
Accession B0DGI8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
62-81CSSICRLSYHRQARRYPRADHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011053  Single_hybrid_motif  
KEGG lbc:LACBIDRAFT_300335  -  
CDD cd06849  lipoyl_domain  
Amino Acid Sequences MAESISERTLKSWSKQVGDTVATDEEIVAIETDSLSSLTCSQNDQCQTRPARSLLPGPLAGCSSICRLSYHRQARRYPRAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.39
4 0.37
5 0.35
6 0.32
7 0.26
8 0.21
9 0.18
10 0.16
11 0.13
12 0.09
13 0.08
14 0.07
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.06
25 0.07
26 0.07
27 0.09
28 0.09
29 0.14
30 0.18
31 0.19
32 0.19
33 0.25
34 0.27
35 0.28
36 0.31
37 0.28
38 0.27
39 0.27
40 0.3
41 0.26
42 0.26
43 0.25
44 0.22
45 0.22
46 0.2
47 0.17
48 0.14
49 0.13
50 0.13
51 0.14
52 0.15
53 0.16
54 0.2
55 0.28
56 0.38
57 0.47
58 0.52
59 0.57
60 0.66
61 0.74