Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YKH7

Protein Details
Accession R7YKH7   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-88AVPATPKKKRGPNKPKKAAENGHydrophilic
94-135EDATPKKTPKRKAAPKESGEDGASPKKRGRKPTIKSEPKVKEBasic
NLS Segment(s)
PositionSequence
72-131PKKKRGPNKPKKAAENGAAEGEEDATPKKTPKRKAAPKESGEDGASPKKRGRKPTIKSEP
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 10.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSQTAGTLDERETRLVAIAMQCLKSGAPDVDLNKFAAMAGYASAASAGNAWRPLKDKIFNTAAVDGAVPATPKKKRGPNKPKKAAENGAAEGEEDATPKKTPKRKAAPKESGEDGASPKKRGRKPTIKSEPKVKEDEEDEDADAELSGGVKKEDQDADADAEEEPTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.17
4 0.13
5 0.17
6 0.18
7 0.18
8 0.18
9 0.17
10 0.17
11 0.15
12 0.16
13 0.12
14 0.12
15 0.15
16 0.17
17 0.21
18 0.22
19 0.22
20 0.19
21 0.18
22 0.15
23 0.12
24 0.1
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.1
37 0.11
38 0.12
39 0.15
40 0.19
41 0.23
42 0.29
43 0.28
44 0.31
45 0.34
46 0.34
47 0.32
48 0.29
49 0.24
50 0.19
51 0.17
52 0.11
53 0.08
54 0.07
55 0.06
56 0.06
57 0.1
58 0.12
59 0.17
60 0.23
61 0.31
62 0.4
63 0.51
64 0.62
65 0.69
66 0.78
67 0.84
68 0.84
69 0.81
70 0.78
71 0.7
72 0.64
73 0.56
74 0.46
75 0.36
76 0.3
77 0.24
78 0.18
79 0.15
80 0.1
81 0.06
82 0.06
83 0.07
84 0.08
85 0.11
86 0.18
87 0.24
88 0.32
89 0.42
90 0.53
91 0.62
92 0.71
93 0.79
94 0.82
95 0.78
96 0.75
97 0.68
98 0.59
99 0.49
100 0.4
101 0.32
102 0.31
103 0.3
104 0.28
105 0.29
106 0.36
107 0.41
108 0.49
109 0.57
110 0.59
111 0.64
112 0.73
113 0.8
114 0.81
115 0.81
116 0.82
117 0.79
118 0.74
119 0.71
120 0.61
121 0.54
122 0.47
123 0.46
124 0.39
125 0.33
126 0.28
127 0.24
128 0.23
129 0.19
130 0.15
131 0.11
132 0.07
133 0.06
134 0.06
135 0.06
136 0.07
137 0.08
138 0.09
139 0.14
140 0.15
141 0.16
142 0.17
143 0.19
144 0.21
145 0.2
146 0.2
147 0.15