Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z6F9

Protein Details
Accession R7Z6F9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-95VDASSKRPKRSGRPRKHPRRPEVRBasic
NLS Segment(s)
PositionSequence
77-95KRPKRSGRPRKHPRRPEVR
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013324  RNA_pol_sigma_r3/r4-like  
Amino Acid Sequences MPNHHRGGRKPGSKELTGTQKAAVIALRDSGLKYSQIAKEANVSAEAARKIVSNTRKSINGSNNLQELLAEVDASSKRPKRSGRPRKHPRRPEVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.55
3 0.55
4 0.5
5 0.46
6 0.37
7 0.33
8 0.31
9 0.29
10 0.23
11 0.15
12 0.12
13 0.12
14 0.12
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.1
21 0.14
22 0.15
23 0.18
24 0.18
25 0.17
26 0.19
27 0.2
28 0.19
29 0.14
30 0.13
31 0.1
32 0.13
33 0.12
34 0.09
35 0.09
36 0.08
37 0.09
38 0.15
39 0.21
40 0.22
41 0.25
42 0.28
43 0.3
44 0.33
45 0.39
46 0.39
47 0.39
48 0.38
49 0.38
50 0.37
51 0.34
52 0.31
53 0.24
54 0.19
55 0.13
56 0.1
57 0.07
58 0.06
59 0.09
60 0.09
61 0.12
62 0.19
63 0.22
64 0.26
65 0.33
66 0.41
67 0.49
68 0.6
69 0.7
70 0.74
71 0.8
72 0.88
73 0.92
74 0.96
75 0.96