Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DGF0

Protein Details
Accession B0DGF0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-75SFFHLRCAHKRRPKPNLMCEKDFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10, cyto_nucl 7.5, cyto 3
Family & Domain DBs
KEGG lbc:LACBIDRAFT_300293  -  
Amino Acid Sequences MHGVLPDLPKLRALGIRIANLTQTALSSVANTIPEEMIANEYAPTFAKFPALSFFHLRCAHKRRPKPNLMCEKDFRVEKDVRISRARNVATALPSIDVIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.28
4 0.28
5 0.27
6 0.25
7 0.22
8 0.21
9 0.13
10 0.1
11 0.08
12 0.08
13 0.07
14 0.07
15 0.07
16 0.08
17 0.09
18 0.08
19 0.08
20 0.07
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.08
35 0.08
36 0.08
37 0.12
38 0.13
39 0.14
40 0.17
41 0.17
42 0.22
43 0.27
44 0.28
45 0.32
46 0.38
47 0.46
48 0.52
49 0.61
50 0.65
51 0.7
52 0.79
53 0.8
54 0.83
55 0.85
56 0.82
57 0.79
58 0.73
59 0.68
60 0.63
61 0.57
62 0.49
63 0.44
64 0.39
65 0.36
66 0.43
67 0.42
68 0.42
69 0.46
70 0.46
71 0.45
72 0.52
73 0.5
74 0.41
75 0.39
76 0.38
77 0.33
78 0.33
79 0.28
80 0.2