Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7YQY0

Protein Details
Accession R7YQY0    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
427-449APAGPVGRKRDKVREKVVKMPVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17.5, cyto_nucl 14, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MADQPADTRKAAEAEPGLFVFSESAPIAHIPPEVPTEAKTTTDAPPASDPQPAPASDPKVEPEAKPEAKPEAKPEAEPEEGPEGELEDEPEDEPAATPKPAPEPAKEPEAPAENLPEEQLVVTTSEGTPIVAVTEPTKPQDAPVPPKETTELVIVPNSPLVPEDSASDTTPEDTPVAETPPLPETAPEPVSEVPAAIIEEAQESRRSSIASSVASSVSEAAKQEEAAAPPEPAPEPAPEVPSAVAGEAQESRRSSVASSAASSVSEVAKPEEAPAPPRTMTEMIKAAPVAMVEAIKGPKETSAASSASSSPALKPTAAEEPPVVPALAEEAHQSRKSSVASSIASSASSTAPPKPVVIEELPVIADPITAIMQDQLPALQDTPKPVTRAPTVAPPPTPVGPSLWSTSVSSVPAVTVLETVPMVAVPAPAGPVGRKRDKVREKVVKMPVLRAVLGSEIAKEFGPGIRAALGMSARG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.24
4 0.22
5 0.19
6 0.19
7 0.15
8 0.11
9 0.13
10 0.1
11 0.1
12 0.11
13 0.12
14 0.12
15 0.12
16 0.13
17 0.11
18 0.13
19 0.16
20 0.16
21 0.16
22 0.17
23 0.2
24 0.2
25 0.21
26 0.21
27 0.21
28 0.23
29 0.29
30 0.28
31 0.27
32 0.3
33 0.33
34 0.32
35 0.35
36 0.32
37 0.3
38 0.33
39 0.3
40 0.31
41 0.33
42 0.36
43 0.33
44 0.35
45 0.32
46 0.35
47 0.37
48 0.32
49 0.32
50 0.36
51 0.37
52 0.37
53 0.38
54 0.4
55 0.43
56 0.45
57 0.46
58 0.45
59 0.43
60 0.43
61 0.44
62 0.41
63 0.38
64 0.36
65 0.33
66 0.29
67 0.27
68 0.26
69 0.21
70 0.16
71 0.15
72 0.15
73 0.13
74 0.08
75 0.09
76 0.09
77 0.1
78 0.09
79 0.08
80 0.08
81 0.09
82 0.11
83 0.1
84 0.11
85 0.12
86 0.17
87 0.23
88 0.26
89 0.27
90 0.31
91 0.34
92 0.41
93 0.4
94 0.36
95 0.34
96 0.35
97 0.33
98 0.28
99 0.28
100 0.21
101 0.21
102 0.2
103 0.16
104 0.11
105 0.1
106 0.09
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.08
113 0.08
114 0.08
115 0.07
116 0.06
117 0.07
118 0.06
119 0.07
120 0.07
121 0.11
122 0.12
123 0.14
124 0.16
125 0.15
126 0.16
127 0.23
128 0.27
129 0.32
130 0.38
131 0.42
132 0.4
133 0.42
134 0.43
135 0.36
136 0.31
137 0.25
138 0.2
139 0.15
140 0.16
141 0.15
142 0.13
143 0.13
144 0.11
145 0.09
146 0.08
147 0.08
148 0.08
149 0.08
150 0.09
151 0.11
152 0.13
153 0.13
154 0.14
155 0.12
156 0.13
157 0.13
158 0.12
159 0.1
160 0.08
161 0.09
162 0.09
163 0.11
164 0.1
165 0.1
166 0.1
167 0.12
168 0.12
169 0.11
170 0.1
171 0.1
172 0.13
173 0.14
174 0.13
175 0.13
176 0.13
177 0.14
178 0.13
179 0.12
180 0.08
181 0.08
182 0.07
183 0.05
184 0.05
185 0.04
186 0.05
187 0.06
188 0.06
189 0.08
190 0.09
191 0.1
192 0.1
193 0.11
194 0.1
195 0.12
196 0.14
197 0.13
198 0.13
199 0.13
200 0.12
201 0.12
202 0.12
203 0.1
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.07
210 0.08
211 0.09
212 0.09
213 0.1
214 0.1
215 0.1
216 0.1
217 0.11
218 0.1
219 0.09
220 0.1
221 0.08
222 0.11
223 0.12
224 0.13
225 0.12
226 0.12
227 0.12
228 0.11
229 0.1
230 0.07
231 0.07
232 0.05
233 0.06
234 0.07
235 0.08
236 0.1
237 0.11
238 0.12
239 0.11
240 0.12
241 0.11
242 0.12
243 0.14
244 0.12
245 0.12
246 0.12
247 0.12
248 0.12
249 0.11
250 0.09
251 0.08
252 0.08
253 0.07
254 0.07
255 0.08
256 0.08
257 0.09
258 0.12
259 0.12
260 0.15
261 0.16
262 0.18
263 0.18
264 0.18
265 0.2
266 0.19
267 0.19
268 0.19
269 0.19
270 0.17
271 0.17
272 0.17
273 0.14
274 0.11
275 0.1
276 0.07
277 0.05
278 0.05
279 0.04
280 0.07
281 0.07
282 0.07
283 0.08
284 0.07
285 0.08
286 0.09
287 0.09
288 0.1
289 0.12
290 0.12
291 0.13
292 0.14
293 0.14
294 0.14
295 0.15
296 0.13
297 0.11
298 0.13
299 0.14
300 0.12
301 0.12
302 0.14
303 0.19
304 0.19
305 0.19
306 0.17
307 0.17
308 0.18
309 0.19
310 0.16
311 0.09
312 0.08
313 0.09
314 0.08
315 0.08
316 0.08
317 0.1
318 0.14
319 0.16
320 0.17
321 0.16
322 0.18
323 0.19
324 0.19
325 0.19
326 0.19
327 0.19
328 0.19
329 0.2
330 0.18
331 0.17
332 0.15
333 0.14
334 0.1
335 0.11
336 0.12
337 0.13
338 0.15
339 0.16
340 0.16
341 0.17
342 0.17
343 0.19
344 0.18
345 0.18
346 0.15
347 0.15
348 0.15
349 0.13
350 0.13
351 0.08
352 0.07
353 0.05
354 0.06
355 0.05
356 0.05
357 0.05
358 0.06
359 0.06
360 0.07
361 0.07
362 0.07
363 0.08
364 0.09
365 0.09
366 0.13
367 0.13
368 0.18
369 0.23
370 0.26
371 0.27
372 0.28
373 0.33
374 0.32
375 0.35
376 0.32
377 0.36
378 0.38
379 0.4
380 0.39
381 0.37
382 0.37
383 0.36
384 0.35
385 0.26
386 0.23
387 0.21
388 0.23
389 0.23
390 0.21
391 0.2
392 0.2
393 0.21
394 0.2
395 0.19
396 0.17
397 0.14
398 0.12
399 0.11
400 0.11
401 0.09
402 0.08
403 0.07
404 0.08
405 0.07
406 0.07
407 0.06
408 0.06
409 0.06
410 0.06
411 0.06
412 0.05
413 0.06
414 0.06
415 0.07
416 0.08
417 0.1
418 0.17
419 0.26
420 0.34
421 0.41
422 0.47
423 0.58
424 0.67
425 0.74
426 0.78
427 0.81
428 0.78
429 0.81
430 0.83
431 0.79
432 0.71
433 0.66
434 0.61
435 0.53
436 0.48
437 0.38
438 0.3
439 0.24
440 0.24
441 0.2
442 0.16
443 0.13
444 0.14
445 0.13
446 0.13
447 0.12
448 0.12
449 0.14
450 0.12
451 0.13
452 0.13
453 0.13
454 0.13
455 0.15