Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7Z0I8

Protein Details
Accession R7Z0I8    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
159-185STNVNRNRCFRHRQRCQHTPRCMIYKKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008704  Endonuclease_Zinc-binding_loop  
IPR044925  His-Me_finger_sf  
IPR044930  Homing_endonuclease_His-Me  
Gene Ontology GO:0004519  F:endonuclease activity  
Pfam View protein in Pfam  
PF05551  zf-His_Me_endon  
Amino Acid Sequences MSTPDGSAAPDKSQNSSSQDASTSSSANAITPKGRKVIVSTPEAKRLLLFRTPKRHWARMKQWYSDVKALTYPGNHRDCWLYPMPYKKKYQGTIRKTFAHTDEKVSYKAGLPFGIVALLIRYQLTREQKKNIVKGWELSHLCGNWTCCNWRHFTIEDHSTNVNRNRCFRHRQRCQHTPRCMIYKKKPLSELTPSPPASQESSQDASEAPATPFRQPPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.36
4 0.35
5 0.31
6 0.31
7 0.28
8 0.29
9 0.26
10 0.21
11 0.17
12 0.17
13 0.15
14 0.15
15 0.16
16 0.14
17 0.19
18 0.21
19 0.23
20 0.25
21 0.26
22 0.25
23 0.29
24 0.35
25 0.34
26 0.38
27 0.42
28 0.42
29 0.49
30 0.49
31 0.44
32 0.37
33 0.34
34 0.32
35 0.32
36 0.37
37 0.37
38 0.47
39 0.5
40 0.59
41 0.64
42 0.69
43 0.7
44 0.73
45 0.75
46 0.75
47 0.79
48 0.72
49 0.72
50 0.69
51 0.65
52 0.59
53 0.49
54 0.39
55 0.34
56 0.31
57 0.25
58 0.22
59 0.21
60 0.24
61 0.26
62 0.25
63 0.25
64 0.27
65 0.27
66 0.29
67 0.29
68 0.25
69 0.25
70 0.36
71 0.41
72 0.43
73 0.46
74 0.48
75 0.51
76 0.53
77 0.6
78 0.6
79 0.62
80 0.66
81 0.67
82 0.64
83 0.59
84 0.56
85 0.49
86 0.46
87 0.38
88 0.34
89 0.32
90 0.3
91 0.29
92 0.27
93 0.23
94 0.18
95 0.19
96 0.15
97 0.12
98 0.1
99 0.1
100 0.09
101 0.08
102 0.06
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.1
111 0.19
112 0.26
113 0.29
114 0.34
115 0.41
116 0.48
117 0.52
118 0.51
119 0.47
120 0.41
121 0.42
122 0.39
123 0.4
124 0.34
125 0.31
126 0.29
127 0.24
128 0.24
129 0.22
130 0.22
131 0.17
132 0.18
133 0.2
134 0.22
135 0.24
136 0.27
137 0.28
138 0.29
139 0.28
140 0.31
141 0.33
142 0.36
143 0.35
144 0.34
145 0.33
146 0.31
147 0.35
148 0.38
149 0.38
150 0.35
151 0.39
152 0.44
153 0.49
154 0.59
155 0.63
156 0.67
157 0.72
158 0.8
159 0.84
160 0.86
161 0.9
162 0.9
163 0.89
164 0.86
165 0.82
166 0.81
167 0.78
168 0.78
169 0.77
170 0.77
171 0.76
172 0.73
173 0.72
174 0.67
175 0.66
176 0.66
177 0.63
178 0.59
179 0.6
180 0.56
181 0.51
182 0.49
183 0.44
184 0.4
185 0.35
186 0.32
187 0.29
188 0.31
189 0.29
190 0.28
191 0.25
192 0.22
193 0.22
194 0.21
195 0.16
196 0.19
197 0.21
198 0.25